TB Genome Annotation Portal

Rv3792 (aftA)

Amino Acid Sequence

MPSRRKSPQFGHEMGAFTSARAREVLVALGQLAAAVVVAVGVAVVSLLAIARVEWPAFPSSNQLHALTTVGQVGCLAGLVGIGWLWRHGRFRRLARLGGL
VLVSAFTVVTLGMPLGATKLYLFGISVDQQFRTEYLTRLTDTAALRDMTYIGLPPFYPPGWFWIGGRAAALTGTPAWEMFKPWAITSMAIAVAVALVLWW
RMIRFEYALLVTVATAAVMLAYSSPEPYAAMITVLLPPMLVLTWSGLGARDRQGWAAVVGAGVFLGFAATWYTLLVAYGAFTVVLMALLLAGSRLQSGIK
AAVDPLCRLAVVGAIAAAIGSTTWLPYLLRAARDPVSDTGSAQHYLPADGAALTFPMLQFSLLGAICLLGTLWLVMRARSSAPAGALAIGVLAVYLWSLL
SMLATLARTTLLSFRLQPTLSVLLVAAGAFGFVEAVQALGKRGRGVIPMAAAIGLAGAIAFSQDIPDVLRPDLTIAYTDTDGYGQRGDRRPPGSEKYYPA
IDAAIRRVTGKRRDRTVVLTADYSFLSYYPYWGFQGLTPHYANPLAQFDKRATQIDSWSGLSTADEFIAALDKLPWQPPTVFLMRHGAHNSYTLRLAQDV
YPNQPNVRRYTVDLRTALFADPRFVVEDIGPFVLAIRKPQESA
(Nucleotide sequence available on KEGG)

Additional Information



ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across ~100 conditions

Rv3792/aftA, gene len: 1931 bp, num TA sites: 33
conditiondatasetcallmediummethodnotes
in-vitroDeJesus 2017 mBioessential7H9HMMfully saturated, 14 TnSeq libraries combined
in-vitroSassetti 2003 Mol Microessential 7H9TRASHessential if hybridization ratio<0.2
in-vivo (mice)Sassetti 2003 PNASno data BL6 miceTRASHessential if hybridization ratio<0.4, min over 4 timepoints (1-8 weeks)
in-vitro (glycerol)Griffin 2011 PPathessentialM9 minimal+glycerolGumbel2 replicates; Padj<0.05
in-vitro (cholesterol)Griffin 2011 PPathessentialM9 minimal+cholesterolGumbel3 replicates; Padj<0.05
differentially essential in cholesterol Griffin 2011 PPathNO (LFC=-1.03)cholesterol vs glycerolresampling-SRYES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in cholesterol
in-vitroSmith 2022 eLifeessential7H9HMM6 replicates (raw data in Subramaniam 2017, PMID 31752678)
in-vivo (mice)Smith 2022 eLifeessentialBL6 miceHMM6 replicates (raw data in Subramaniam 2017, PMID 31752678)
differentially essential in miceSmith 2022 eLifeNO (LFC=0.015)in-vivo vs in-vitroZINBYES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in mice
in-vitro (minimal)Minato 2019 mSysessentialminimal mediumHMM
in-vitro (YM rich medium)Minato 2019 mSysessentialYM rich mediumHMM7H9 supplemented with ~20 metabolites (amino acids, cofactors)
differentially essential in YM rich mediumMinato 2019 mSysNO (LFC=0.92)YM rich vs minimal mediumresampling

Analysis of Positive Selection in Clinical Isolates *new*

global set of 10,626 Mtb clinical isolates
under significant positive selection?NO
omega peak height (95%CI lower bound)1.54 (0.57)
codons under selection
omega plotsomega plot across ORF
genetic variants*link
* example format for variants: "D27 (GAC): D27H (CAC,11)" means "Asp27 (native codon GAC) mutated to His (codon CAC) in 11 isolates"



TnSeq Data No data currently available.
  • No TnSeq data currently available for this Target.
RNASeq Data No data currently available.
  • No RNA-Seq data currently available for this Target.
Metabolomic Profiles No data currently available.
  • No Metabolomic data currently available for this Target.
Proteomic Data No data currently available.
  • No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology
  • BioCyc

    Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

    NOTE: see table of TFOE interactions below

    Interactions based on ChIPSeq data

  • Interactions based on ChIPSeq data (Minch et al. 2014)

    • Binds To:

      • No bindings to other targets were found.
    • Bound By:

      • No bindings to other targets were found.

    Interactions based on TFOE data (Rustad et al. 2014)

    TFOE = Transcription Factor Over-Expression study
    significance criteria used in paper: greater than 2-fold change (|LFC|>=1.0) and Padj<0.01

    genedysregulated by OE ofLFC
    Rv3792/aftARv3286c/sigF1.07
    Rv3792/aftARv0023/--1.42
    • Upregulates:

      • Does not upregulate other genes.
    • Upregulated by:

    • Downregulates:

      • Does not downregulate other genes.
    • Downregulated by:



    TBCAP

    Tubculosis Community Annotation Project (
    Slayden et al., 2013)

    Rv3792 (aftA)

    PropertyValueCreatorEvidencePMIDComment
    CitationIdentification of a novel arabinofuranosyltransferase (AftA) involved in cell wall arabinan biosynthesis in Mycobacterium tuberculosis. LJ. Alderwick, M. Seidel et al. J. Biol. Chem. 2006njamshidiIDA16595677see PMID: 16595677 and cole et al text (Tuberculosis and the tubercle bacillus) for more details. Priming reaction for subsequent addition of arabinan
    TermTBRXN:AFTA arabinofuranosyl transferase (M tb) - IDAnjamshidiIDA16595677see PMID: 16595677 and cole et al text (Tuberculosis and the tubercle bacillus) for more details. Priming reaction for subsequent addition of arabinan
    LJ. Alderwick, M. Seidel et al. Identification of a novel arabinofuranosyltransferase (AftA) involved in cell wall arabinan biosynthesis in Mycobacterium tuberculosis. J. Biol. Chem. 2006
    CitationIdentification of a novel arabinofuranosyltransferase (AftA) involved in cell wall arabinan biosynthesis in Mycobacterium tuberculosis. LJ. Alderwick, M. Seidel et al. J. Biol. Chem. 2006njamshidiISS16595677see PMID: 16595677 and cole et al text (Tuberculosis and the tubercle bacillus) for more details. Priming reaction for subsequent addition of arabinan
    TermTBRXN:AFTA arabinofuranosyl transferase (M tb) - ISSnjamshidiISS16595677see PMID: 16595677 and cole et al text (Tuberculosis and the tubercle bacillus) for more details. Priming reaction for subsequent addition of arabinan
    LJ. Alderwick, M. Seidel et al. Identification of a novel arabinofuranosyltransferase (AftA) involved in cell wall arabinan biosynthesis in Mycobacterium tuberculosis. J. Biol. Chem. 2006
    NameDecaprenol phosphoarabinose-dependent arabinosyltransferase that transfers the first arabinosyl residue to the galactan backbonemjacksonIDAArabinosyltransferases
    SymbolaftCmjacksonIMPArabinosyltransferases
    NameDecaprenol phosphoarabinose-dependent arabinosyltransferase which transfers an arabinosyl unit to the 3 position of an arabinosyl residuemjacksonIMPArabinosyltransferases
    SymbolaftCmjacksonIDAArabinosyltransferases
    NameDecaprenol phosphoarabinose-dependent arabinosyltransferase which transfers an arabinosyl unit to the 3 position of an arabinosyl residuemjacksonIDAArabinosyltransferases
    SymbolaftAmjacksonIMPArabinosyltransferases
    NameDecaprenol phosphoarabinose-dependent arabinosyltransferase that transfers the first arabinosyl residue to the galactan backbonemjacksonIMPArabinosyltransferases
    SymbolaftAmjacksonIDAArabinosyltransferases
    SymbolaftCmmcneilDecaprenol phosphoarabinose-dependent arabinosyltransferase which transferase an arabinosyl unit to the 3 position of an arabinosyl residue
    HL. Birch, LJ. Alderwick et al. Biosynthesis of mycobacterial arabinogalactan: identification of a novel alpha(1-->3) arabinofuranosyltransferase. Mol. Microbiol. 2008
    CitationBiosynthesis of mycobacterial arabinogalactan: identification of a novel alpha(1-->3) arabinofuranosyltransferase. HL. Birch, LJ. Alderwick et al. Mol. Microbiol. 2008mmcneil18627460Decaprenol phosphoarabinose-dependent arabinosyltransferase which transferase an arabinosyl unit to the 3 position of an arabinosyl residue
    TermGO:0052636 arabinosyltransferase activity - NRmmcneilNRDecaprenol phosphoarabinose-dependent arabinosyltransferase which transferase an arabinosyl unit to the 3 position of an arabinosyl residue
    HL. Birch, LJ. Alderwick et al. Biosynthesis of mycobacterial arabinogalactan: identification of a novel alpha(1-->3) arabinofuranosyltransferase. Mol. Microbiol. 2008
    SymbolafTAmmcneilDecaprenol phosphoarabinose-dependent arabinosyltransferase that transferase the first arabinosyl residue to the galactan backbone
    LJ. Alderwick, M. Seidel et al. Identification of a novel arabinofuranosyltransferase (AftA) involved in cell wall arabinan biosynthesis in Mycobacterium tuberculosis. J. Biol. Chem. 2006
    CitationIdentification of a novel arabinofuranosyltransferase (AftA) involved in cell wall arabinan biosynthesis in Mycobacterium tuberculosis. LJ. Alderwick, M. Seidel et al. J. Biol. Chem. 2006mmcneil16595677Decaprenol phosphoarabinose-dependent arabinosyltransferase that transferase the first arabinosyl residue to the galactan backbone
    TermGO:0052636 arabinosyltransferase activity - NRmmcneilNRDecaprenol phosphoarabinose-dependent arabinosyltransferase that transferase the first arabinosyl residue to the galactan backbone
    LJ. Alderwick, M. Seidel et al. Identification of a novel arabinofuranosyltransferase (AftA) involved in cell wall arabinan biosynthesis in Mycobacterium tuberculosis. J. Biol. Chem. 2006
    CitationRoles of conserved proline and glycosyltransferase motifs of EmbC in biosynthesis of lipoarabinomannan. S. Berg, J. Starbuck et al. J. Biol. Chem. 2005jjmcfadden15546869Inferred from direct assay
    TermEC:2.4.2.34 Indolylacetylinositol arabinosyltransferase. - NRjjmcfaddenNRInferred from direct assay
    S. Berg, J. Starbuck et al. Roles of conserved proline and glycosyltransferase motifs of EmbC in biosynthesis of lipoarabinomannan. J. Biol. Chem. 2005
    CitationRoles of conserved proline and glycosyltransferase motifs of EmbC in biosynthesis of lipoarabinomannan. S. Berg, J. Starbuck et al. J. Biol. Chem. 2005extern:JZUCKER15546869Inferred from direct assay
    TermEC:2.4.2.34 Indolylacetylinositol arabinosyltransferase. - NRextern:JZUCKERNRInferred from direct assay
    S. Berg, J. Starbuck et al. Roles of conserved proline and glycosyltransferase motifs of EmbC in biosynthesis of lipoarabinomannan. J. Biol. Chem. 2005

    Comments