Rv3791 (dprE2)
Current annotations:
TBCAP: (community-based annotations - see table at bottom of page )
TBDB: oxidoreductase
REFSEQ: short chain dehydrogenase
PATRIC: 3-oxoacyl-[acyl-carrier protein] reductase paralog (EC 1.1.1.100)
TUBERCULIST: Decaprenylphosphoryl-D-2-keto erythro pentose reductase
NCBI: Decaprenylphosphoryl-D-2-keto erythro pentose reductase
updated information (H37Rv4):
gene name: dprE2
function:
reference:
Coordinates in H37Rv: 4237165 - 4237929
Gene length: 765 bp (with stop codon), 254 aa (without stop codon)
Operon:
Trans-membrane region:
Role: I.B.7 - Miscellaneous oxidoreductases and oxygenases
GO terms:
Reaction(s) (based on iSM810 metabolic model):
Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
Orthologs among selected mycobacteria
Protein structure:
Search for Latest Homologs in PDB
Top 10 Homologs in PDB (as of Apr 2026): PDB aa ident species PDB title 6TQ8 36% Starmerella magnoliae Alcohol dehydrogenase from Candida magnoliae DSMZ 70638 (ADHA): thermostable 10fold mutant
Links to additional information on dprE2:
Amino Acid Sequence
MVLDAVGNPQTVLLLGGTSEIGLAICERYLHNSAARIVLACLPDDPRREDAAAAMKQAGARSVELIDFDALDTDSHPKMIEAAFSGGDVDVAIVAFGLLG
DAEELWQNQRKAVQIAEINYTAAVSVGVLLAEKMRAQGFGQIIAMSSAAGERVRRANFVYGSTKAGLDGFYLGLSEALREYGVRVLVIRPGQVRTRMSAH
LKEAPLTVDKEYVANLAVTASAKGKELVWAPAAFRYVMMVLRHIPRSIFRKLPI
(
Nucleotide sequence available on
KEGG )
Additional Information
MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb
TnSeqCorr - genes with correlated TnSeq profiles across ~100 conditions
Rv3791/dprE2,
gene len: 764 bp, num TA sites: 12
condition dataset call medium method notes
in-vitro DeJesus 2017 mBio essential 7H9 HMM fully saturated, 14 TnSeq libraries combined
in-vitro Sassetti 2003 Mol Micro essential 7H9 TRASH essential if hybridization ratio<0.2
in-vivo (mice) Sassetti 2003 PNAS non-essential BL6 mice TRASH essential if hybridization ratio<0.4, min over 4 timepoints (1-8 weeks)
in-vitro (glycerol) Griffin 2011 PPath essential M9 minimal+glycerol Gumbel 2 replicates; Padj<0.05
in-vitro (cholesterol) Griffin 2011 PPath essential M9 minimal+cholesterol Gumbel 3 replicates; Padj<0.05
differentially essential in cholesterol Griffin 2011 PPath NO (LFC=0.0) cholesterol vs glycerol resampling-SR YES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in cholesterol
in-vitro Smith 2022 eLife essential 7H9 HMM 6 replicates (raw data in Subramaniam 2017, PMID 31752678)
in-vivo (mice) Smith 2022 eLife essential BL6 mice HMM 6 replicates (raw data in Subramaniam 2017, PMID 31752678)
differentially essential in mice Smith 2022 eLife NO (LFC=0.0) in-vivo vs in-vitro ZINB YES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in mice
in-vitro (minimal) Minato 2019 mSys growth defect minimal medium HMM
in-vitro (YM rich medium) Minato 2019 mSys essential YM rich medium HMM 7H9 supplemented with ~20 metabolites (amino acids, cofactors)
differentially essential in YM rich medium Minato 2019 mSys NO (LFC=0.0) YM rich vs minimal medium resampling
Analysis of Positive Selection in Clinical Isolates
*new*
data from Culviner et al (2025) (55,259 Mtb clinical isolates)
overall pN/pS for Rv3791: 0.577890724
lineage-specific pN/pS in L1: 0.770520966
lineage-specific pN/pS in L2: 1.107623888
lineage-specific pN/pS in L3: 0.719152901
lineage-specific pN/pS in L4: 0.426750073
Analysis of dN/dS (omega) in a global collection of 10k Mtb clinical isolates using GenomegaMap (Window model)
clinical isolates collection: global set of 10,626 Mtb genomes
In the omega plots, the black line shows the mean estimate of omega (dN/dS) at each codon, and the blue lines are the bounds for the 95% credible interval (95%CI, from MCMC sampling).
A gene is under significant positive selection if the lower-bound of the 95%CI of omega (lower blue line) exceeds 1.0 at any codon.
global set of 10,626 Mtb clinical isolates
under significant positive selection? NO
omega peak height (95%CI lower bound) 1.07 (0.39)
codons under selection
omega plots
genetic variants* link
* example format for variants: "D27 (GAC): D27H (CAC,11)" means "Asp27 (native codon GAC) mutated to His (codon CAC) in 11 isolates"
TnSeq Data No data currently available.
No TnSeq data currently available for this Target.
RNASeq Data No data currently available.
No RNA-Seq data currently available for this Target.
Metabolomic Profiles No data currently available.
No Metabolomic data currently available for this Target.
Proteomic Data No data currently available.
No Proteomic data currently available for this Target.
Regulatory Relationships from Systems Biology
BioCyc
Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology )
NOTE:
see table of TFOE interactions below
Interactions based on ChIPSeq data
RNA processing and modification
Energy production and conversion
Chromatin structure and dynamics
Amino acid transport and metabolism
Cell cycle control, cell division, chromosome partitioning
Carbohydrate transport and metabolism
Nucleotide transport and metabolism
Lipid transport and metabolism
Coenzyme transport and metabolism
Translation, ribosomal structure and biogenesis
Cell wall/membrane/envelope biogenesis
Replication, recombination and repair
Posttranslational modification, protein turnover, chaperones
Secondary metabolites biosynthesis, transport and catabolism
Inorganic ion transport and metabolism
General function prediction only
Intracellular trafficking, secretion, and vesicular transport
Signal transduction mechanisms
Differentially expressed as result of RNASeq in glycerol environment (Only top 20 genes shown sorted by log fold change with p_adj 0.05).
Conditionally essential as result of TNSeq (Only top 20 genes shown sorted by log fold change with p_adj 0.05).
Binds To:
No bindings to other targets were found.
Bound By:
No bindings from other targets were found.
Binds To:
No bindings to other targets were found.
Bound By:
No bindings to other targets were found.
TFOE = Transcription Factor Over-Expression study
significance criteria used in paper: greater than 2-fold change (|LFC|>=1.0) and Padj<0.01
no significant interactions found
Upregulates:
Does not upregulate other genes.
Upregulated by:
Not upregulated by other genes.
Downregulates:
Does not downregulate other genes.
Downregulated by:
Not downregulated by other genes.
Property Value Creator Evidence PMID Comment
Citation Decaprenylphosphoryl arabinofuranose, the donor of the D-arabinofuranosyl residues of mycobacterial arabinan, is formed via a two-step epimerization of decaprenylphosphoryl ribose. K. Mikusov, H. Huang et al. J. Bacteriol. 2005 njamshidi IDA 16291675 see PMID: 16291675. lumped reaction, believed to be two step epimerization of ribose to arabinofuranose
Term TBRXN:DCPE decaprenylphosphoryl ribose, arabinofuranose isomerization - IDA njamshidi IDA 16291675 see PMID: 16291675. lumped reaction, believed to be two step epimerization of ribose to arabinofuranoseK. Mikusov, H. Huang et al. Decaprenylphosphoryl arabinofuranose, the donor of the D-arabinofuranosyl residues of mycobacterial arabinan, is formed via a two-step epimerization of decaprenylphosphoryl ribose. J. Bacteriol. 2005
Citation Decaprenylphosphoryl arabinofuranose, the donor of the D-arabinofuranosyl residues of mycobacterial arabinan, is formed via a two-step epimerization of decaprenylphosphoryl ribose. K. Mikusov, H. Huang et al. J. Bacteriol. 2005 njamshidi IPI 16291675 see PMID: 16291675. lumped reaction, believed to be two step epimerization of ribose to arabinofuranose
Term TBRXN:DCPE decaprenylphosphoryl ribose, arabinofuranose isomerization - IPI njamshidi IPI 16291675 see PMID: 16291675. lumped reaction, believed to be two step epimerization of ribose to arabinofuranoseK. Mikusov, H. Huang et al. Decaprenylphosphoryl arabinofuranose, the donor of the D-arabinofuranosyl residues of mycobacterial arabinan, is formed via a two-step epimerization of decaprenylphosphoryl ribose. J. Bacteriol. 2005
Symbol dprE2 mjackson IDA Decaprenyl phosphoarabinose synthesis
Name decaprenylphosphoryl-D-arabinose synthase (AKA decaprenylphosphoryl-D-2-keto erythro pentuose reductase) forming decaprenyl-P-arabinose mjackson IDA Decaprenyl phosphoarabinose synthesis
Symbol dprE2 mmcneil decaprenylphosphoryl-D-arabinose synthase (AKA decaprenylphosphoryl-D-2-keto erythro pentuose reductase) forming decaprenyl-P-arabinose; enzymatic evidenceK. Mikusov, H. Huang et al. Decaprenylphosphoryl arabinofuranose, the donor of the D-arabinofuranosyl residues of mycobacterial arabinan, is formed via a two-step epimerization of decaprenylphosphoryl ribose. J. Bacteriol. 2005
Citation Decaprenylphosphoryl arabinofuranose, the donor of the D-arabinofuranosyl residues of mycobacterial arabinan, is formed via a two-step epimerization of decaprenylphosphoryl ribose. K. Mikusov, H. Huang et al. J. Bacteriol. 2005 mmcneil 16291675 decaprenylphosphoryl-D-arabinose synthase (AKA decaprenylphosphoryl-D-2-keto erythro pentuose reductase) forming decaprenyl-P-arabinose; enzymatic evidence
Term GO:0009247 glycolipid biosynthetic process - NR mmcneil NR decaprenylphosphoryl-D-arabinose synthase (AKA decaprenylphosphoryl-D-2-keto erythro pentuose reductase) forming decaprenyl-P-arabinose; enzymatic evidenceK. Mikusov, H. Huang et al. Decaprenylphosphoryl arabinofuranose, the donor of the D-arabinofuranosyl residues of mycobacterial arabinan, is formed via a two-step epimerization of decaprenylphosphoryl ribose. J. Bacteriol. 2005
Citation Identification and active expression of the Mycobacterium tuberculosis gene encoding 5-phospho-{alpha}-d-ribose-1-diphosphate: decaprenyl-phosphate 5-phosphoribosyltransferase, the first enzyme committed to decaprenylphosphoryl-d-arabinose synthesis. H. Huang, MS. Scherman et al. J. Biol. Chem. 2005 jjmcfadden 15878857 Inferred from direct assay
Term EC:1.-.-.- Oxidoreductases. - NR jjmcfadden NR Inferred from direct assayH. Huang, MS. Scherman et al. Identification and active expression of the Mycobacterium tuberculosis gene encoding 5-phospho-{alpha}-d-ribose-1-diphosphate: decaprenyl-phosphate 5-phosphoribosyltransferase, the first enzyme committed to decaprenylphosphoryl-d-arabinose synthesis. J. Biol. Chem. 2005
Citation Identification and active expression of the Mycobacterium tuberculosis gene encoding 5-phospho-{alpha}-d-ribose-1-diphosphate: decaprenyl-phosphate 5-phosphoribosyltransferase, the first enzyme committed to decaprenylphosphoryl-d-arabinose synthesis. H. Huang, MS. Scherman et al. J. Biol. Chem. 2005 extern:JZUCKER 15878857 Inferred from direct assay
Term EC:1.-.-.- Oxidoreductases. - NR extern:JZUCKER NR Inferred from direct assayH. Huang, MS. Scherman et al. Identification and active expression of the Mycobacterium tuberculosis gene encoding 5-phospho-{alpha}-d-ribose-1-diphosphate: decaprenyl-phosphate 5-phosphoribosyltransferase, the first enzyme committed to decaprenylphosphoryl-d-arabinose synthesis. J. Biol. Chem. 2005