TB Genome Annotation Portal

Rv3764c (tcrY)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: two-component system OmpR family sensor kinase
  • REFSEQ: two component sensor kinase
  • PATRIC: sensor histidine kinase
  • TUBERCULIST: Possible two component sensor kinase TcrY
  • NCBI: Possible two component sensor kinase TcrY
  • updated information (H37Rv4):
    • gene name: tcrY
    • function:
    • reference:
• Type: Not Target
• Start: 4209582
• End: 4211009
• Operon:


• Trans-membrane region:
  
• Role: I.J.2 - Two component systems
• GO terms:
  • GO:0046777 - protein autophosphorylation (Uniprot)
  • GO:0042803 - protein homodimerization activity (Uniprot)
  • GO:0023014 - signal transduction by protein phosphorylation (Uniprot)
  • GO:0018106 - peptidyl-histidine phosphorylation (Uniprot)
  • GO:0016887 - ATPase activity (Uniprot)
  • GO:0016772 - transferase activity, transferring phosphorus-containing groups (Uniprot)
  • GO:0016740 - transferase activity (Uniprot)
  • GO:0016310 - phosphorylation (Uniprot)
  • GO:0016301 - kinase activity (Uniprot)
  • GO:0016021 - integral component of membrane (Uniprot)
  • GO:0016020 - membrane (Uniprot)
  • GO:0007165 - signal transduction (Uniprot)
  • GO:0005886 - plasma membrane (Uniprot)
  • GO:0005829 - cytosol (Uniprot)
  • GO:0005524 - ATP binding (Uniprot)
  • GO:0005515 - protein binding (Uniprot)
  • GO:0005509 - calcium ion binding (Uniprot)
  • GO:0004871 - signal transducer activity (Uniprot)
  • GO:0004673 - protein histidine kinase activity (Uniprot)
  • GO:0000287 - magnesium ion binding (Uniprot)
  • GO:0000166 - nucleotide binding (Uniprot)
  • GO:0000160 - phosphorelay signal transduction system (Uniprot)
  • GO:0000155 - phosphorelay sensor kinase activity (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure:
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020):
  

  PDB	aa ident	species	PDB title
  5UKY	52%	Mycobacterium tuberculosis	DHp domain of PhoR of M. tuberculosis - native data
  5UKV	52%	Mycobacterium tuberculosis	DHp domain of PhoR of M. tuberculosis - SeMet
  1YSR	36%	Mycobacterium tuberculosis	Crystal Structure of ATP binding domain of PrrB from Mycobacterium Tuberculosis
  1YS3	36%	Mycobacterium tuberculosis	Crystal Structure of the ATP binding domain of PrrB from Mycobacterium Tuberculosis
  1R62	35%	Escherichia coli	Crystal structure of the C-terminal Domain of the Two-Component System Transmitter Protein NRII (NtrB)
  6BLK	35%	Mycobacterium hassiacum (strain DSM 44199 / CIP 105218 / JCM 12690 / 3849)	Mycobacterial sensor histidine kinase MprB

• Links to additional information on tcrY:
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = -11.365 (from Jeremy Rock's lab)
  • KEGG - nucleotide and amino acid sequences of gene
  • Mycobrowser
  • PATRIC
  • BioCyc
  • Systems Biology

Amino Acid Sequence

VGITAATEMALRRHLVAQLDNQLGGTSYRSVLMYPEKMPRPPWRHETHNYIRSGPGPRFLDAPGQPAGMVAAVVSDGTTVAAGYLTGSGSRAALTSTGRS
QLERIAGSRTPLTLDLDGLGRYRVLAAPSRNGHDVIVTGLSMGNVDATMLQMLIIFGIVTVIALVAATTAGIVIIKRALAPLRRVAQTASEVVDLPLDRG
EVKLPVRVPEPDANPSTEVGQLGSALNRMLDHIAAALSARQASETCVRQFVADASHELRTPLAAIRGYTELTQRIGDDPEAVAHAMSRVASETERITRLV
EDLLLLARLDSGRPLERGPVDMSRLAVDAVSDAHVAGPDHQWALDLPPEPVVIPGDAARLHQVVTNLLANARVHTGPGTIVTTRLSTGPTHVVLQVIDNG
PGIPAALQSEVFERFARGDTSRSRQAGSTGLGLAIVSAVVKAHNGTITVSSSPGYTEFAVRLPLDGWQPLESSPR

Additional Information