TB Genome Annotation Portal

Rv3733c (-)

Amino Acid Sequence

MPKLSAGVLLYRARAGVVDVLLAHPGGPFWAGKDDGAWSIPKGEYTGGEDPWLAARREFSEEIGLCVPDGPRIDFGSLKQSGGKVVTVFGVRADLDITDA
RSSTFELDWPKGSGKMRKFPEVDRVSWFPVARARTKLLKGQRGFLDRLMAHPAVAGLSEGPESLPR
(Nucleotide sequence available on KEGG)

Additional Information



ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across ~100 conditions

Rv3733c/-, gene len: 500 bp, num TA sites: 4
conditiondatasetcallmediummethodnotes
in-vitroDeJesus 2017 mBionon-essential7H9HMMfully saturated, 14 TnSeq libraries combined
in-vitroSassetti 2003 Mol Micronon-essential 7H9TRASHessential if hybridization ratio<0.2
in-vivo (mice)Sassetti 2003 PNASnon-essential BL6 miceTRASHessential if hybridization ratio<0.4, min over 4 timepoints (1-8 weeks)
in-vitro (glycerol)Griffin 2011 PPathnon-essentialM9 minimal+glycerolGumbel2 replicates; Padj<0.05
in-vitro (cholesterol)Griffin 2011 PPathnon-essentialM9 minimal+cholesterolGumbel3 replicates; Padj<0.05
differentially essential in cholesterol Griffin 2011 PPathNO (LFC=-0.48)cholesterol vs glycerolresampling-SRYES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in cholesterol
in-vitroSmith 2022 eLifenon-essential7H9HMM6 replicates (raw data in Subramaniam 2017, PMID 31752678)
in-vivo (mice)Smith 2022 eLifenon-essentialBL6 miceHMM6 replicates (raw data in Subramaniam 2017, PMID 31752678)
differentially essential in miceSmith 2022 eLifeNO (LFC=-0.28)in-vivo vs in-vitroZINBYES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in mice
in-vitro (minimal)Minato 2019 mSysnon-essentialminimal mediumHMM
in-vitro (YM rich medium)Minato 2019 mSysnon-essentialYM rich mediumHMM7H9 supplemented with ~20 metabolites (amino acids, cofactors)
differentially essential in YM rich mediumMinato 2019 mSysNO (LFC=-0.11)YM rich vs minimal mediumresampling

Analysis of Positive Selection in Clinical Isolates *new*

global set of 10,626 Mtb clinical isolates
under significant positive selection?NO
omega peak height (95%CI lower bound)0.83 (0.43)
codons under selection
omega plotsomega plot across ORF
genetic variants*link
* example format for variants: "D27 (GAC): D27H (CAC,11)" means "Asp27 (native codon GAC) mutated to His (codon CAC) in 11 isolates"



TnSeq Data No data currently available.
  • No TnSeq data currently available for this Target.
RNASeq Data No data currently available.
  • No RNA-Seq data currently available for this Target.
Metabolomic Profiles No data currently available.
  • No Metabolomic data currently available for this Target.
Proteomic Data No data currently available.
  • No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology
  • BioCyc

    Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

    NOTE: see table of TFOE interactions below

    Interactions based on ChIPSeq data

    • Binds To:

      • No bindings to other targets were found.
    • Bound By:

    Interactions based on ChIPSeq data (Minch et al. 2014)

    Interactions based on TFOE data (Rustad et al. 2014)

    TFOE = Transcription Factor Over-Expression study
    significance criteria used in paper: greater than 2-fold change (|LFC|>=1.0) and Padj<0.01

    genedysregulated by OE ofLFC
    Rv3733c/-Rv0324/--1.3
    • Upregulates:

      • Does not upregulate other genes.
    • Upregulated by:

      • Not upregulated by other genes.
    • Downregulates:

      • Does not downregulate other genes.
    • Downregulated by:



    TBCAP

    Tubculosis Community Annotation Project (
    Slayden et al., 2013)

    Rv3733c (-)

    PropertyValueCreatorEvidencePMIDComment
    CitationOver-producing soluble protein complex and validating protein-protein interaction through a new bacterial co-expression system. J. Zeng, L. Zhang et al. Protein Expr. Purif. 2010jlew19747546interacts with Rv3097c. Using an in vivo pull-down assay, for the first time we have confirmed the presence of three pairs of PE/PPE-related novel protein interactions in this pathogen.

    Comments