TB Genome Annotation Portal

Rv3708c (asd)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: aspartate-semialdehyde dehydrogenase
  • REFSEQ: aspartate-semialdehyde dehydrogenase
  • PATRIC: Aspartate-semialdehyde dehydrogenase (EC 1.2.1.11)
  • TUBERCULIST: Aspartate-semialdehyde dehydrogenase Asd (ASA dehydrogenase) (ASADH) (aspartic semialdehyde dehydrogenase) (L-aspartate-beta-semialdehyde dehydrogenase)
  • NCBI: Aspartate-semialdehyde dehydrogenase Asd (ASA dehydrogenase) (ASADH) (aspartic semialdehyde dehydrogenase) (L-aspartate-beta-semialdehyde dehydrogenase)
  • updated information (H37Rv4):
    • gene name: asd
    • function:
    • reference:
• Type: Not Target
• Start: 4151180
• End: 4152217
• Operon:


• Trans-membrane region:
  
• Role: I.D.2 - Aspartate family
• GO terms:
  • GO:0055114 - oxidation-reduction process (Uniprot)
  • GO:0051287 - NAD binding (Uniprot)
  • GO:0050661 - NADP binding (Uniprot)
  • GO:0046983 - protein dimerization activity (Uniprot)
  • GO:0040007 - growth (Uniprot)
  • GO:0019877 - diaminopimelate biosynthetic process (Uniprot)
  • GO:0016620 - oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor (Uniprot)
  • GO:0016491 - oxidoreductase activity (Uniprot)
  • GO:0009405 - pathogenesis (Uniprot)
  • GO:0009097 - isoleucine biosynthetic process (Uniprot)
  • GO:0009089 - lysine biosynthetic process via diaminopimelate (Uniprot)
  • GO:0009088 - threonine biosynthetic process (Uniprot)
  • GO:0009086 - methionine biosynthetic process (Uniprot)
  • GO:0009085 - lysine biosynthetic process (Uniprot)
  • GO:0008652 - cellular amino acid biosynthetic process (Uniprot)
  • GO:0006520 - cellular amino acid metabolic process (Uniprot)
  • GO:0005886 - plasma membrane (Uniprot)
  • GO:0005737 - cytoplasm (Uniprot)
  • GO:0005618 - cell wall (Uniprot)
  • GO:0005515 - protein binding (Uniprot)
  • GO:0004073 - aspartate-semialdehyde dehydrogenase activity (Uniprot)
  • GO:0003942 - N-acetyl-gamma-glutamyl-phosphate reductase activity (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
  • NADPH[c] + ASP4P[c] -> PI[c] + NADP[c] + ASPSA[c]
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure: 3tz6, 3llg, 3vos
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020):
  

  PDB	aa ident	species	PDB title
  3VOS	100%	Mycobacterium tuberculosis	Crystal structure of Aspartate semialdehyde dehydrogenase Complexed With glycerol and sulfate From Mycobacterium tuberculosis H37Rv
  3TZ6	100%	Mycobacterium tuberculosis	Crystal structure of Aspartate semialdehyde dehydrogenase Complexed With inhibitor SMCS (CYS) And Phosphate From Mycobacterium tuberculosis H37Rv
  2R00	42%	Vibrio cholerae	crystal structure of aspartate semialdehyde dehydrogenase II complexed with ASA from vibrio cholerae
  2R00	42%	Vibrio cholerae	crystal structure of aspartate semialdehyde dehydrogenase II complexed with ASA from vibrio cholerae
  2QZ9	42%	Vibrio cholerae	crystal structure of aspartate semialdehyde dehydrogenase II from vibrio cholerae
  2YV3	41%	Thermus thermophilus	Crystal Structure of Aspartate Semialdehyde Dehydrogenase from Thermus thermophilus HB8
  4R5H	39%	Streptococcus pneumoniae	Crystal structure of sp-Aspartate-Semialdehyde-Dehydrogenase with Nicotinamide-Adenine-Dinucleotide-Phosphate and 3-carboxy-propenyl-phthalic acid
  4R54	39%	Streptococcus pneumoniae	Complex crystal structure of sp-Aspartate-Semialdehyde-Dehydrogenase with 3-carboxy-ethyl-phthalic acid
  4R51	39%	Streptococcus pneumoniae	Crystal complex structure of sp-Aspartate-Semialdehyde-Dehydrogenase with Nicotinamide Adenine dinucleotide phosphate and phthalic acid
  4R4J	39%	Streptococcus pneumoniae	Crystal structure of complex sp_ASADH with 3-carboxypropyl-phthalic acid and Nicotinamide Adenine dinucleotide phosphate

• Links to additional information on asd:
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = -6.973 (from Jeremy Rock's lab)
  • KEGG - nucleotide and amino acid sequences of gene
  • Mycobrowser
  • PATRIC
  • BioCyc
  • Systems Biology

Amino Acid Sequence

MGLSIGIVGATGQVGQVMRTLLDERDFPASAVRFFASARSQGRKLAFRGQEIEVEDAETADPSGLDIALFSAGSAMSKVQAPRFAAAGVTVIDNSSAWRK
DPDVPLVVSEVNFERDAHRRPKGIIANPNCTTMAAMPVLKVLHDEARLVRLVVSSYQAVSGSGLAGVAELAEQARAVIGGAEQLVYDGGALEFPPPNTYV
APIAFNVVPLAGSLVDDGSGETDEDQKLRFESRKILGIPDLLVSGTCVRVPVFTGHSLSINAEFAQPLSPERARELLDGATGVQLVDVPTPLAAAGVDES
LVGRIRRDPGVPDGRGLALFVSGDNLRKGAALNTIQIAELLTADL

Additional Information