TB Genome Annotation Portal

Rv3602c (panC)

Amino Acid Sequence

MTIPAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRVPGSVVVVSIFVNPMQFGAGEDLDAYPRTPDDDLAQLRAEGVEI
AFTPTTAAMYPDGLRTTVQPGPLAAELEGGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVAVVGVPTVREADGLAMSSRNR
YLDPAQRAAAVALSAALTAAAHAATAGAQAALDAARAVLDAAPGVAVDYLELRDIGLGPMPLNGSGRLLVAARLGTTRLLDNIAIEIGTFAGTDRPDGYR
AILESHWRN
(Nucleotide sequence available on KEGG)

Additional Information



ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across ~100 conditions

Rv3602c/panC, gene len: 929 bp, num TA sites: 13
conditiondatasetcallmediummethodnotes
in-vitroDeJesus 2017 mBioessential7H9HMMfully saturated, 14 TnSeq libraries combined
in-vitroSassetti 2003 Mol Microessential 7H9TRASHessential if hybridization ratio<0.2
in-vivo (mice)Sassetti 2003 PNASno data BL6 miceTRASHessential if hybridization ratio<0.4, min over 4 timepoints (1-8 weeks)
in-vitro (glycerol)Griffin 2011 PPathessentialM9 minimal+glycerolGumbel2 replicates; Padj<0.05
in-vitro (cholesterol)Griffin 2011 PPathessentialM9 minimal+cholesterolGumbel3 replicates; Padj<0.05
differentially essential in cholesterol Griffin 2011 PPathNO (LFC=0.0)cholesterol vs glycerolresampling-SRYES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in cholesterol
in-vitroSmith 2022 eLifeessential7H9HMM6 replicates (raw data in Subramaniam 2017, PMID 31752678)
in-vivo (mice)Smith 2022 eLifeessentialBL6 miceHMM6 replicates (raw data in Subramaniam 2017, PMID 31752678)
differentially essential in miceSmith 2022 eLifeNO (LFC=0.0)in-vivo vs in-vitroZINBYES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in mice
in-vitro (minimal)Minato 2019 mSysessentialminimal mediumHMM
in-vitro (YM rich medium)Minato 2019 mSysnon-essentialYM rich mediumHMM7H9 supplemented with ~20 metabolites (amino acids, cofactors)
differentially essential in YM rich mediumMinato 2019 mSysYES (LFC=6.93)YM rich vs minimal mediumresampling

Analysis of Positive Selection in Clinical Isolates *new*

global set of 10,626 Mtb clinical isolates
under significant positive selection?NO
omega peak height (95%CI lower bound)1.67 (0.61)
codons under selection
omega plotsomega plot across ORF
genetic variants*link
* example format for variants: "D27 (GAC): D27H (CAC,11)" means "Asp27 (native codon GAC) mutated to His (codon CAC) in 11 isolates"



TnSeq Data No data currently available.
  • No TnSeq data currently available for this Target.
RNASeq Data No data currently available.
  • No RNA-Seq data currently available for this Target.
Metabolomic Profiles No data currently available.
  • No Metabolomic data currently available for this Target.
Proteomic Data No data currently available.
  • No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology
  • BioCyc

    Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

    NOTE: see table of TFOE interactions below

    Interactions based on ChIPSeq data

    • Binds To:

      • No bindings to other targets were found.
    • Bound By:

    Interactions based on ChIPSeq data (Minch et al. 2014)

    Interactions based on TFOE data (Rustad et al. 2014)

    TFOE = Transcription Factor Over-Expression study
    significance criteria used in paper: greater than 2-fold change (|LFC|>=1.0) and Padj<0.01

    genedysregulated by OE ofLFC
    Rv3602c/panCRv3058c/--1.4
    • Upregulates:

      • Does not upregulate other genes.
    • Upregulated by:

      • Not upregulated by other genes.
    • Downregulates:

      • Does not downregulate other genes.
    • Downregulated by:



    TBCAP

    Tubculosis Community Annotation Project (
    Slayden et al., 2013)

    Rv3602c (panC)

    PropertyValueCreatorEvidencePMIDComment
    InteractionRegulatedBy Rv0981yamir.morenoIEPMicroarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
    H. He, R. Hovey et al. MprAB is a stress-responsive two-component system that directly regulates expression of sigma factors SigB and SigE in Mycobacterium tuberculosis. J. Bacteriol. 2006
    CitationActive site residues in Mycobacterium tuberculosis pantothenate synthetase required in the formation and stabilization of the adenylate intermediate. authors,R. Zheng,TK. Dam,CF. Brewer,JS. Blanchard Biochemistry 2004jevans15170354Highly conserved residues His44, His47, Asn69, Gln72 and Lys160 are essential for formationof the pantoyl-adenylate intermediate
    CitationThe design and synthesis of inhibitors of pantothenate synthetase. authors,KL. Tuck,SA. Saldanha,LM. Birch,AG. Smith,C. Abell Org. Biomol. Chem. 2006jevans16990935Analogues of the pantoyl-adenylate intermediate in which the phosphodiester is replaced by a sulfamoyl group are potent inhibitors.
    CitationA novel inhibitor of Mycobacterium tuberculosis pantothenate synthetase. EL. White, K. Southworth et al. Journal of biomolecular screening : the official journal of the Society for Biomolecular Screening 2007jevans17175524Inhibited by the vasodilator, nafronyl oxalate, but no whole cell activity in vitro.
    Citation5-tert-butyl-N-pyrazol-4-yl-4,5,6,7-tetrahydrobenzo[d]isoxazole-3-carboxamide derivatives as novel potent inhibitors of Mycobacterium tuberculosis pantothenate synthetase: initiating a quest for new antitubercular drugs. authors,S. Velaparthi,M. Brunsteiner,R. Uddin,B. Wan,SG. Franzblau,PA. Petukhov J. Med. Chem. 2008jevans18335974The tert-butyl and pyrazole portions of 5-tert-Butyl-N-pyrazol-4-yl-4,5,6,7-tetrahydrobenzo[d]isoxazole-3-carboxamide derivatives are crucial for pantothenate synthetase inhibition.
    CitationApplication of fragment growing and fragment linking to the discovery of inhibitors of Mycobacterium tuberculosis pantothenate synthetase. authors,AW. Hung,HL. Silvestre,S. Wen,A. Ciulli,TL. Blundell,C. Abell Angew. Chem. Int. Ed. Engl. 2009jevans197800865-methoxyindole competitively inhibits ATP binding.
    CitationA comparison of the dynamics of pantothenate synthetase from M. tuberculosis and E. coli: computational studies. authors,YS. Tan,G. Fuentes,C. Verma Proteins 2011jevans21425349N-terminal domain gate loop motions dominate in Mtb pantothenate synthetase, as opposed to C-terminal domain motions that dominate in E. coli PS
    CitationA discovery of novel Mycobacterium tuberculosis pantothenate synthetase inhibitors based on the molecular mechanism of actinomycin D inhibition. authors,Y. Yang,P. Gao,Y. Liu,X. Ji,M. Gan,Y. Guan,X. Hao,Z. Li,C. Xiao Bioorg. Med. Chem. Lett. 2011jevans21641210Weakly inhibited by actinomycin D
    CitationPositional isotope exchange analysis of the pantothenate synthetase reaction. authors,L. Williams,R. Zheng,JS. Blanchard,FM. Raushel Biochemistry 2003jevans12718554Catalyses the formation of a pantoyl-adenylate intermediate upon the ordered addition of ATP and pantoate.

    Comments