TB Genome Annotation Portal

Rv3597c (lsr2)

Amino Acid Sequence

MAKKVTVTLVDDFDGSGAADETVEFGLDGVTYEIDLSTKNATKLRGDLKQWVAAGRRVGGRRRGRSGSGRGRGAIDREQSAAIREWARRNGHNVSTRGRI
PADVIDAYHAAT
(Nucleotide sequence available on KEGG)

Additional Information



ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across >100 conditions *new*

Classification Condition Strain Method Reference Notes
Uncertain Sodium Oleate H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: 0.972250;
5 non-insertions in a row out of 5 sites
Uncertain Lignoceric Acid H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: 0.990150;
5 non-insertions in a row out of 5 sites
Essential Phosphatidylcholine H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: 0.991250;
5 non-insertions in a row out of 5 sites
Uncertain minimal media + 0.1% glycerol H37RvMA Gumbel Griffin et al. (2011) Probability of Essentiality: 0.988550;
5 non-insertions in a row out of 5 sites
Uncertain minimal media + 0.01% cholesterol H37RvMA Gumbel Griffin et al. (2011) Probability of Essentiality: 0.987600;
5 non-insertions in a row out of 5 sites
Essential 7H10-glycerol H37RvMA TraSH Sassetti et al. (2003a)
Essential C57BL/6J mice (8 weeks) H37RvMA TraSH Sassetti et al. (2003b) Hybridization Ratio: 0.1
Growth-Defect 7H09/7H10 + rich media H37RvMA MotifHMM DeJesus et al. (2017) Fully saturated (14 reps).

TnSeq Data No data currently available.
  • No TnSeq data currently available for this Target.
RNASeq Data No data currently available.
  • No RNA-Seq data currently available for this Target.
Metabolomic Profiles No data currently available.
  • No Metabolomic data currently available for this Target.
Proteomic Data No data currently available.
  • No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology
  • BioCyc

    Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

    NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

    Interactions based on ChIPSeq data

  • Interactions based on ChIPSeq data (Minch et al. 2014)

    Interactions based on TFOE data (Rustad et al. 2014)



    TBCAP

    Tubculosis Community Annotation Project (
    Slayden et al., 2013)

    Rv3597c (lsr2)

    PropertyValueCreatorEvidencePMIDComment
    CitationTranscriptional regulation of multi-drug tolerance and antibiotic-induced responses by the histone-like protein Lsr2 in M. tuberculosis. R. Colangeli, D. Helb et al. PLoS Pathog. 2007sourish10IEP17590082Co-expression (Functional linkage)
    InteractionTranscription Rv0342sourish10IEPCo-expression (Functional linkage)
    R. Colangeli, D. Helb et al. Transcriptional regulation of multi-drug tolerance and antibiotic-induced responses by the histone-like protein Lsr2 in M. tuberculosis. PLoS Pathog. 2007
    InteractionTranscription Rv0343sourish10IEPCo-expression (Functional linkage)
    R. Colangeli, D. Helb et al. Transcriptional regulation of multi-drug tolerance and antibiotic-induced responses by the histone-like protein Lsr2 in M. tuberculosis. PLoS Pathog. 2007
    InteractionTranscription Rv0341sourish10IEPCo-expression (Functional linkage)
    R. Colangeli, D. Helb et al. Transcriptional regulation of multi-drug tolerance and antibiotic-induced responses by the histone-like protein Lsr2 in M. tuberculosis. PLoS Pathog. 2007
    InteractionTranscription Rv2846csourish10IEPCo-expression (Functional linkage)
    R. Colangeli, D. Helb et al. Transcriptional regulation of multi-drug tolerance and antibiotic-induced responses by the histone-like protein Lsr2 in M. tuberculosis. PLoS Pathog. 2007
    InteractionPhysicalInteraction Rv2412kholia.truptiIEPChIP (Physical interaction)
    BR. Gordon,Y. Li,L. Wang,A. Sintsova,H. van Bakel,S. Tian,WW. Navarre,B. Xia,J. Liu Lsr2 is a nucleoid-associated protein that targets AT-rich sequences and virulence genes in Mycobacterium tuberculosis. Proc. Natl. Acad. Sci. U.S.A. 2010
    InteractionRegulatory Rv3924cextern:JZUCKERTAS
    BR. Gordon,Y. Li,L. Wang,A. Sintsova,H. van Bakel,S. Tian,WW. Navarre,B. Xia,J. Liu Lsr2 is a nucleoid-associated protein that targets AT-rich sequences and virulence genes in Mycobacterium tuberculosis. Proc. Natl. Acad. Sci. U.S.A. 2010
    InteractionRegulatory Rv3924cextern:JZUCKERTAS
    authors,L. Salazar Inhibition of chromosome replication in Mycobacterium smegmatis: effect of the rpmH-dnaA promoter region. Microbiology (Reading, Engl.) 2000

    Comments