TB Genome Annotation Portal

Rv3588c (canB)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: carbonic anhydrase
  • REFSEQ: carbonic anhydrase
  • PATRIC: Carbonic anhydrase (EC 4.2.1.1)
  • TUBERCULIST: Beta-carbonic anhydrase CanB
  • NCBI: Beta-carbonic anhydrase CanB
  • updated information (H37Rv4):
    • gene name: canB
    • function:
    • reference:
• Type: Not Target
• Start: 4029871
• End: 4030494
• Operon:


• Trans-membrane region:
  
• Role: IV.I - Miscellaneous phosphatases, lyases, and hydrolases
• GO terms:
  • GO:0046872 - metal ion binding (Uniprot)
  • GO:0016829 - lyase activity (Uniprot)
  • GO:0015976 - carbon utilization (Uniprot)
  • GO:0008270 - zinc ion binding (Uniprot)
  • GO:0005515 - protein binding (Uniprot)
  • GO:0004089 - carbonate dehydratase activity (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
  • CO2[c] -> HCO3[c]
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure: 1ym3, 2a5v
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020):
  

  PDB	aa ident	species	PDB title
  2A5V	100%	Mycobacterium tuberculosis	Crystal structure of M. tuberculosis beta carbonic anhydrase, Rv3588c, tetrameric form
  1YM3	100%	Mycobacterium tuberculosis	Crystal Structure of carbonic anhydrase RV3588c from Mycobacterium tuberculosis
  3UCO	37%	Coccomyxa sp. PA	Coccomyxa beta-carbonic anhydrase in complex with iodide
  3UCN	37%	Coccomyxa sp. PA	Coccomyxa beta-carbonic anhydrase in complex with azide
  3UCM	37%	Coccomyxa sp. PA	Coccomyxa beta-carbonic anhydrase in complex with thiocyanate
  3UCK	37%	Coccomyxa sp. PA	Coccomyxa beta-carbonic anhydrase in complex with phosphate
  3UCJ	37%	Coccomyxa sp. PA	Coccomyxa beta-carbonic anhydrase in complex with acetazolamide

• Links to additional information on canB:
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = 0.71 (from Jeremy Rock's lab)
  • KEGG - nucleotide and amino acid sequences of gene
  • Mycobrowser
  • PATRIC
  • BioCyc
  • Systems Biology
  • Photo of spot titer

Amino Acid Sequence

MPNTNPVAAWKALKEGNERFVAGRPQHPSQSVDHRAGLAAGQKPTAVIFGCADSRVAAEIIFDQGLGDMFVVRTAGHVIDSAVLGSIEYAVTVLNVPLIV
VLGHDSCGAVNAALAAINDGTLPGGYVRDVVERVAPSVLLGRRDGLSRVDEFEQRHVHETVAILMARSSAISERIAGGSLAIVGVTYQLDDGRAVLRDHI
GNIGEEV

Additional Information