TB Genome Annotation Portal

Rv3535c (hsaG)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: acetaldehyde dehydrogenase
  • REFSEQ: acetaldehyde dehydrogenase
  • PATRIC: Acetaldehyde dehydrogenase acetylating (EC 1.2.1.10) in gene cluster for degradation of phenols cresols catechol
  • TUBERCULIST: Probable acetaldehyde dehydrogenase (acetaldehyde dehydrogenase [acetylating])
  • NCBI: Probable acetaldehyde dehydrogenase (acetaldehyde dehydrogenase [acetylating])
  • updated information (H37Rv4):
    • gene name: hsaG
    • function:
    • reference:
• Type: Not Target
• Start: 3973589
• End: 3974500
• Operon:


• Trans-membrane region:
  
• Role: I.B.7 - Miscellaneous oxidoreductases and oxygenases
• GO terms:
  • GO:0055114 - oxidation-reduction process (Uniprot)
  • GO:0051287 - NAD binding (Uniprot)
  • GO:0019439 - aromatic compound catabolic process (Uniprot)
  • GO:0016620 - oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor (Uniprot)
  • GO:0016491 - oxidoreductase activity (Uniprot)
  • GO:0008774 - acetaldehyde dehydrogenase (acetylating) activity (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
  • 3 COA[c] + 4ANDROSTENEDIONE[c] -> PYR[c] + 3 PROPIONYLCOA[c]
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure: 4jn6
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020):
  

  PDB	aa ident	species	PDB title
  4JN6	100%	Mycobacterium tuberculosis	Crystal Structure of the Aldolase-Dehydrogenase Complex from Mycobacterium tuberculosis HRv37
  4LRT	71%	Thermomonospora curvata	Crystal and solution structures of the bifunctional enzyme (Aldolase/Aldehyde dehydrogenase) from Thermomonospora curvata, reveal a cofactor-binding domain motion during NAD+ and CoA accommodation whithin the shared cofactor-binding site
  4LRS	71%	Thermomonospora curvata	Crystal and solution structures of the bifunctional enzyme (Aldolase/Aldehyde dehydrogenase) from Thermomonospora curvata, reveal a cofactor-binding domain motion during NAD+ and CoA accommodation whithin the shared cofactor-binding site
  1NVM	55%	Pseudomonas sp.	Crystal structure of a bifunctional aldolase-dehydrogenase : sequestering a reactive and volatile intermediate

• Links to additional information on hsaG:
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = 0.555 (from Jeremy Rock's lab)
  • KEGG - nucleotide and amino acid sequences of gene
  • Mycobrowser
  • PATRIC
  • BioCyc
  • Systems Biology

Amino Acid Sequence

MPSKAKVAIVGSGNISTDLLYKLLRSEWLEPRWMVGIDPESDGLARAAKLGLETTHEGVDWLLAQPDKPDLVFEATSAYVHRDAAPKYAEAGIRAIDLTP
AAVGPAVIPPANLREHLDAPNVNMITCGGQATIPIVYAVSRIVEVPYAEIVASVASVSAGPGTRANIDEFTKTTARGVQTIGGAARGKAIIILNPADPPM
IMRDTIFCAIPTDADREAIAASIHDVVKEVQTYVPGYRLLNEPQFDEPSINSGGQALVTTFVEVEGAGDYLPPYAGNLDIMTAAATKVGEEIAKETLVVG
GAR

Additional Information