TB Genome Annotation Portal

Rv3518c (cyp142)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: cytochrome P450 monooxygenase 142 cyp142
  • REFSEQ: cytochrome P450 monooxygenase 142
  • PATRIC: putative cytochrome P450 hydroxylase
  • TUBERCULIST: Probable cytochrome P450 monooxygenase 142 Cyp142
  • NCBI: Probable cytochrome P450 monooxygenase 142 Cyp142
  • updated information (H37Rv4):
    • gene name: cyp142
    • function:
    • reference:
• Type: Not Target
• Start: 3954325
• End: 3955521
• Operon:


• Trans-membrane region:
  
• Role: IV.F - Cytochrome P450 enzymes
• GO terms:
  • GO:0055114 - oxidation-reduction process (Uniprot)
  • GO:0046872 - metal ion binding (Uniprot)
  • GO:0036199 - cholest-4-en-3-one 26-monooxygenase activity (Uniprot)
  • GO:0031073 - cholesterol 26-hydroxylase activity (Uniprot)
  • GO:0020037 - heme binding (Uniprot)
  • GO:0016705 - oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen (Uniprot)
  • GO:0016491 - oxidoreductase activity (Uniprot)
  • GO:0016042 - lipid catabolic process (Uniprot)
  • GO:0009405 - pathogenesis (Uniprot)
  • GO:0008203 - cholesterol metabolic process (Uniprot)
  • GO:0008202 - steroid metabolic process (Uniprot)
  • GO:0006707 - cholesterol catabolic process (Uniprot)
  • GO:0006629 - lipid metabolic process (Uniprot)
  • GO:0005618 - cell wall (Uniprot)
  • GO:0005506 - iron ion binding (Uniprot)
  • GO:0004497 - monooxygenase activity (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
  • CHOLESTENONE[c] -> 3OXOCHOLEST4EN26OATE[c]
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure: 2xkr
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020):
  

  PDB	aa ident	species	PDB title
  2XKR	100%	MYCOBACTERIUM TUBERCULOSIS	Crystal Structure of Mycobacterium tuberculosis CYP142: A novel cholesterol oxidase
  4UAX	78%	Mycobacterium smegmatis	X-ray crystal structure of ligand free CYP142A2 from Mycobacterium smegmatis
  4TRI	78%	Mycobacterium smegmatis	X-ray crystal structure of CYP142A2 from Mycobacterium smegmatis, complexed with cholesterol sulfate.
  3ZBY	78%	Mycobacterium smegmatis str. MC2 155	Ligand-free structure of CYP142 from Mycobacterium smegmatis
  2YOO	78%	Mycobacterium smegmatis str. MC2 155	Cholest-4-en-3-one bound structure of CYP142 from Mycobacterium smegmatis
  6GK6	36%	Sorangium cellulosum	Crystal structure of myxobacterial cytochrome P450 CYP267B1 in complex with myristic acid
  6GK5	36%	Sorangium cellulosum	Crystal structure of cytochrome P450 CYP267B1 from Sorangium cellulosum So ce56
  4Z5P	36%	Streptomyces atroolivaceus	Crystal structure of the LnmA cytochrome P450 hydroxylase from the leinamycin biosynthetic pathway of Streptomyces atroolivaceus S-140 at 1.9 A resolution
  5XW2	36%	Streptomyces himastatinicus ATCC 53653	Crystal structure of the Hydroxylase HmtN in C 1 2 1 crystal form
  4E2P	36%	Streptomyces himastatinicus	Crystal Structure of a Post-tailoring Hydroxylase (HmtN) Involved in the Himastatin Biosynthesis

• Links to additional information on cyp142:
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = 0.87 (from Jeremy Rock's lab)
  • KEGG - nucleotide and amino acid sequences of gene
  • Mycobrowser
  • PATRIC
  • BioCyc
  • Systems Biology

Amino Acid Sequence

MTEAPDVDLADGNFYASREARAAYRWMRANQPVFRDRNGLAAASTYQAVIDAERQPELFSNAGGIRPDQPALPMMIDMDDPAHLLRRKLVNAGFTRKRVK
DKEASIAALCDTLIDAVCERGECDFVRDLAAPLPMAVIGDMLGVRPEQRDMFLRWSDDLVTFLSSHVSQEDFQITMDAFAAYNDFTRATIAARRADPTDD
LVSVLVSSEVDGERLSDDELVMETLLILIGGDETTRHTLSGGTEQLLRNRDQWDLLQRDPSLLPGAIEEMLRWTAPVKNMCRVLTADTEFHGTALCAGEK
MMLLFESANFDEAVFCEPEKFDVQRNPNSHLAFGFGTHFCLGNQLARLELSLMTERVLRRLPDLRLVADDSVLPLRPANFVSGLESMPVVFTPSPPLG

Additional Information