TB Genome Annotation Portal

Rv3464 (rmlB)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: dTDP-glucose 46-dehydratase
  • REFSEQ: dTDP-glucose 46-dehydratase RMLB
  • PATRIC: dTDP-glucose 46-dehydratase (EC 4.2.1.46)
  • TUBERCULIST: dTDP-glucose 46-dehydratase RmlB
  • NCBI: dTDP-glucose 4,6-dehydratase RmlB
  • updated information (H37Rv4):
    • gene name: rmlB
    • function:
    • reference:
• Type: Not Target
• Start: 3881837
• End: 3882832
• Operon:


• Trans-membrane region:
  
• Role: I.C.3 - Sugar nucleotides
• GO terms:
  • GO:0070404 - NADH binding (Uniprot)
  • GO:0045226 - extracellular polysaccharide biosynthetic process (Uniprot)
  • GO:0040007 - growth (Uniprot)
  • GO:0019305 - dTDP-rhamnose biosynthetic process (Uniprot)
  • GO:0016829 - lyase activity (Uniprot)
  • GO:0009225 - nucleotide-sugar metabolic process (Uniprot)
  • GO:0008460 - dTDP-glucose 4,6-dehydratase activity (Uniprot)
  • GO:0005618 - cell wall (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
  • DTDPGLC[c] <=> DTDP4DH6DGLC[c]
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure:
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020):
  

  PDB	aa ident	species	PDB title
  1OC2	60%	STREPTOCOCCUS SUIS	The structure of NADH in the dTDP-D-glucose dehydratase (RmlB) enzyme
  1KET	60%	Streptococcus suis	The crystal structure of dTDP-D-glucose 4,6-dehydratase (RmlB) from Streptococcus suis with thymidine diphosphate bound
  1KER	60%	Streptococcus suis	The crystal structure of dTDP-D-glucose 4,6-dehydratase (RmlB) from Streptococcus suis with dTDP-D-glucose bound
  1KEP	60%	Streptococcus suis	The crystal structure of dTDP-D-glucose 4,6-dehydratase (RmlB) from Streptococcus suis with dTDP-xylose bound
  2HUN	50%	Pyrococcus horikoshii	Crystal structure of hypothetical protein PH0414 from Pyrococcus horikoshii OT3
  1R66	48%	Streptomyces venezuelae	Crystal Structure of DesIV (dTDP-glucose 4,6-dehydratase) from Streptomyces venezuelae with NAD and TYD bound
  1R6D	47%	Streptomyces venezuelae	Crystal Structure of DesIV double mutant (dTDP-glucose 4,6-dehydratase) from Streptomyces venezuelae with NAD and DAU bound
  6BI4	46%	Bacillus anthracis str. Ames	2.9 Angstrom Resolution Crystal Structure of dTDP-Glucose 4,6-dehydratase (rfbB) from Bacillus anthracis str. Ames in Complex with NAD.
  1BXK	46%	Escherichia coli	DTDP-GLUCOSE 4,6-DEHYDRATASE FROM E. COLI
  1KEW	43%	Salmonella enterica subsp. enterica serovar Typhimurium	The crystal structure of dTDP-D-glucose 4,6-dehydratase (RmlB) from Salmonella enterica serovar Typhimurium with thymidine diphosphate bound

• Links to additional information on rmlB:
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = -0.115 (from Jeremy Rock's lab)
  • KEGG - nucleotide and amino acid sequences of gene
  • Mycobrowser
  • PATRIC
  • BioCyc
  • Systems Biology

Amino Acid Sequence

MRLLVTGGAGFIGTNFVHSAVREHPDDAVTVLDALTYAGRRESLADVEDAIRLVQGDITDAELVSQLVAESDAVVHFAAESHVDNALDNPEPFLHTNVIG
TFTILEAVRRHGVRLHHISTDEVYGDLELDDRARFTESTPYNPSSPYSATKAGADMLVRAWVRSYGVRATISNCSNNYGPYQHVEKFIPRQITNVLTGRR
PKLYGAGANVRDWIHVDDHNSAVRRILDRGRIGRTYLISSEGERDNLTVLRTLLRLMDRDPDDFDHVTDRVGHDLRYAIDPSTLYDELCWAPKHTDFEEG
LRTTIDWYRDNESWWRPLKDATEARYQERGQ

Additional Information