TB Genome Annotation Portal

Rv3457c (rpoA)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: DNA-directed RNA polymerase subunit alpha
  • REFSEQ: DNA-directed RNA polymerase subunit alpha
  • PATRIC: DNA-directed RNA polymerase alpha subunit (EC 2.7.7.6)
  • TUBERCULIST: Probable DNA-directed RNA polymerase (alpha chain) RpoA (transcriptase alpha chain) (RNA polymerase alpha subunit) (DNA-directed RNA nucleotidyltransferase)
  • NCBI: Probable DNA-directed RNA polymerase (alpha chain) RpoA (transcriptase alpha chain) (RNA polymerase alpha subunit) (DNA-directed RNA nucleotidyltransferase)
  • updated information (H37Rv4):
    • gene name: rpoA
    • function:
    • reference:
• Type: Not Target
• Start: 3877464
• End: 3878507
• Operon:


• Trans-membrane region:
  
• Role: II.A.7 - RNA synthesis, RNA modification and DNA transcription
• GO terms:
  • GO:0046983 - protein dimerization activity (Uniprot)
  • GO:0040007 - growth (Uniprot)
  • GO:0016779 - nucleotidyltransferase activity (Uniprot)
  • GO:0016740 - transferase activity (Uniprot)
  • GO:0006354 - DNA-templated transcription, elongation (Uniprot)
  • GO:0006351 - transcription, DNA-templated (Uniprot)
  • GO:0005886 - plasma membrane (Uniprot)
  • GO:0005829 - cytosol (Uniprot)
  • GO:0005618 - cell wall (Uniprot)
  • GO:0003899 - DNA-directed 5'-3' RNA polymerase activity (Uniprot)
  • GO:0003677 - DNA binding (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure:
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020):
  

  PDB	aa ident	species	PDB title
  6VW0	100%	Mycobacterium tuberculosis	Mycobacterium tuberculosis RNAP S456L mutant open promoter complex
  6VVZ	100%	Mycobacterium tuberculosis	Mycobacterium tuberculosis RNAP S456L mutant transcription initiation intermediate structure with Sorangicin
  6VVY	100%	Mycobacterium tuberculosis	Mycobacterium tuberculosis WT RNAP transcription open promoter complex with Sorangicin
  6VVX	100%	Mycobacterium tuberculosis	Mycobacterium tuberculosis WT RNAP transcription initiation intermediate structure with Sorangicin
  6TYG	100%	Mycobacterium tuberculosis	Crystal structure of MTB sigma L transcription initiation complex with 9 nt long RNA primer
  6TYF	100%	Mycobacterium tuberculosis	Crystal structure of MTB sigma L transcription initiation complex with 6 nt long RNA primer
  6TYE	100%	Mycobacterium tuberculosis	Crystal structure of MTB sigma L transcription initiation complex with 5 nt long RNA primer
  6M7J	100%	Mycobacterium tuberculosis	Mycobacterium tuberculosis RNAP with RbpA/us fork and Corallopyronin
  6KOQ	100%	Mycobacterium tuberculosis H37Rv	Mycobacterium tuberculosis initial transcription complex comprising sigma H and 5'-OH RNA of 10 nt
  6KOP	100%	Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)	Mycobacterium tuberculosis initial transcription complex comprising sigma H and 5'-OH RNA of 9 nt

• Links to additional information on rpoA:
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = -11.266 (from Jeremy Rock's lab)
  • KEGG - nucleotide and amino acid sequences of gene
  • Mycobrowser
  • PATRIC
  • BioCyc
  • Systems Biology

Amino Acid Sequence

MLISQRPTLSEDVLTDNRSQFVIEPLEPGFGYTLGNSLRRTLLSSIPGAAVTSIRIDGVLHEFTTVPGVKEDVTEIILNLKSLVVSSEEDEPVTMYLRKQ
GPGEVTAGDIVPPAGVTVHNPGMHIATLNDKGKLEVELVVERGRGYVPAVQNRASGAEIGRIPVDSIYSPVLKVTYKVDATRVEQRTDFDKLILDVETKN
SISPRDALASAGKTLVELFGLARELNVEAEGIEIGPSPAEADHIASFALPIDDLDLTVRSYNCLKREGVHTVGELVARTESDLLDIRNFGQKSIDEVKIK
LHQLGLSLKDSPPSFDPSEVAGYDVATGTWSTEGAYDEQDYAETEQL

Additional Information