TB Genome Annotation Portal

Rv3449 (mycP4)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: type VII secretion-associated serine protease mycosin
  • REFSEQ: membrane-anchored mycosin
  • PATRIC: subtilase family protein
  • TUBERCULIST: Probable membrane-anchored mycosin MycP4 (serine protease) (subtilisin-like protease) (subtilase-like) (mycosin-4)
  • NCBI: Probable membrane-anchored mycosin MycP4 (serine protease) (subtilisin-like protease) (subtilase-like) (mycosin-4)
  • updated information (H37Rv4):
    • gene name: mycP4
    • function:
    • reference:
• Type: Not Target
• Start: 3869752
• End: 3871119
• Operon:


• Trans-membrane region:
  
• Role: II.C.2 - Surface polysaccharides, lipopolysaccharides, proteins and antigens
• GO terms:
  • GO:0016787 - hydrolase activity (Uniprot)
  • GO:0016021 - integral component of membrane (Uniprot)
  • GO:0016020 - membrane (Uniprot)
  • GO:0008236 - serine-type peptidase activity (Uniprot)
  • GO:0008233 - peptidase activity (Uniprot)
  • GO:0006508 - proteolysis (Uniprot)
  • GO:0005886 - plasma membrane (Uniprot)
  • GO:0004252 - serine-type endopeptidase activity (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure:
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020):
  

  PDB	aa ident	species	PDB title
  4M1Z	48%	Mycobacterium smegmatis	Crystal structure of MycP1 with the N-terminal propeptide removed
  4KG7	46%	Mycobacterium smegmatis	Structure of MycP3 protease from the type VII (ESX-3) secretion system.
  4HVL	45%	Mycobacterium thermoresistibile	Structure of a serine protease MycP1, an essential component of the type VII (ESX-1) secretion system
  4KB5	45%	Mycobacterium smegmatis	Crystal structure of MycP1 from Mycobacterium smegmatis
  4KPG	45%	Mycobacterium smegmatis	Crystal structure of MycP1 from the ESX-1 type VII secretion system
  4J94	45%	Mycobacterium smegmatis	Crystal structure of MycP1 from the ESX-1 type VII secretion system

• Links to additional information on mycP4:
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = 1.415 (from Jeremy Rock's lab)
  • KEGG - nucleotide and amino acid sequences of gene
  • Mycobrowser
  • PATRIC
  • BioCyc
  • Systems Biology

Amino Acid Sequence

MTTSRTLRLLVVSALATLSGLGTPVAHAVSPPPIDERWLPESALPAPPRPTVQREVCTEVTAESGRAFGRAERSAQLADLDQVWRLTRGAGQRVAVIDTG
VARHRRLPKVVAGGDYVFTGDGTADCDAHGTLVAGIIAAAPDAQSDNFSGVAPDVTLISIRQSSSKFAPVGDPSSTGVGDVDTMAKAVRTAADLGASVIN
ISSIACVPAAAAPDDRALGAALAYAVDVKNAVIVAAAGNTGGAAQCPPQAPGVTRDSVTVAVSPAWYDDYVLTVGSVNAQGEPSAFTLAGPWVDVAATGE
AVTSLSPFGDGTVNRLGGQHGSIPISGTSYAAPVVSGLAALIRARFPTLTARQVMQRIESTAHHPPAGWDPLVGNGTVDALAAVSSDSIPQAGTATSDPA
PVAVPVPRRSTPGPSDRRALHTAFAGAAICLLALMATLATASRRLRPGRNGIAGD

Additional Information