TB Genome Annotation Portal

Rv3432c (gadB)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: glutamate decarboxylase
  • REFSEQ: glutamate decarboxylase GadB
  • PATRIC: Glutamate decarboxylase (EC 4.1.1.15)
  • TUBERCULIST: Probable glutamate decarboxylase GadB
  • NCBI: Probable glutamate decarboxylase GadB
  • updated information (H37Rv4):
    • gene name: gadB
    • function:
    • reference:
• Type: Not Target
• Start: 3850372
• End: 3851754
• Operon:


• Trans-membrane region:
  
• Role: I.C.1 - General
• GO terms:
  • GO:0030170 - pyridoxal phosphate binding (Uniprot)
  • GO:0019752 - carboxylic acid metabolic process (Uniprot)
  • GO:0016831 - carboxy-lyase activity (Uniprot)
  • GO:0016829 - lyase activity (Uniprot)
  • GO:0006536 - glutamate metabolic process (Uniprot)
  • GO:0004351 - glutamate decarboxylase activity (Uniprot)
  • GO:0003824 - catalytic activity (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
  • GLU[c] -> CO2[c] + GABA[c]
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure:
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020):
  

  PDB	aa ident	species	PDB title
  3FZ8	50%	Escherichia coli K-12	Crystal structure of glutamate decarboxylase beta from Escherichia coli: reduced Schiff base with PLP
  3FZ7	50%	Escherichia coli K-12	Crystal structure of apo glutamate decarboxylase beta from Escherichia coli
  3FZ6	50%	Escherichia coli K-12	Crystal structure of glutamate decarboxylase beta from Escherichia coli: complex with xenon
  2DGM	50%	Escherichia coli	Crystal structure of Escherichia coli GadB in complex with iodide
  2DGL	50%	Escherichia coli	Crystal structure of Escherichia coli GadB in complex with bromide
  2DGK	50%	Escherichia coli	Crystal structure of an N-terminal deletion mutant of Escherichia coli GadB in an autoinhibited state (aldamine)
  1XEY	50%	Escherichia coli	Crystal structure of the complex of Escherichia coli GADA with glutarate at 2.05 A resolution
  1PMO	50%	Escherichia coli	Crystal structure of Escherichia coli GadB (neutral pH)
  1PMM	50%	Escherichia coli	Crystal structure of Escherichia coli GadB (low pH)
  3HBX	48%	Arabidopsis thaliana	Crystal structure of GAD1 from Arabidopsis thaliana

• Links to additional information on gadB:
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = 0.935 (from Jeremy Rock's lab)
  • KEGG - nucleotide and amino acid sequences of gene
  • Mycobrowser
  • PATRIC
  • BioCyc
  • Systems Biology

Amino Acid Sequence

VSRSHPSVPAHSIAPAYTGRMFTAPVPALRMPDESMDPEAAYRFIHDELMLDGSSRLNLATFVTTWMDPEAEKLMAETFDKNMIDKDEYPATAAIEARCV
SMVADLFHAEGLRDHDPTSATGVSTIGSSEAVMLGGLALKWRWRQRVGSWKGRMPNLVMGSNVQVVWEKFCRYFDVEPRYLPMERGRYVITPEQVLAAVD
ENTIGVVAILGTTYTGELEPIAEICAALDKLAAGGGVDVPVHVDAASGGFVVPFLHPDLVWDFRLPRVVSINVSGHKYGLTYPGVGFVVWRGPEHLPEDL
VFRVNYLGGDMPTFTLNFSRPGNQVVGQYYNFLRLGRDGYTKVMQALSHTARWLGDQLREVDHCEVISDGSAIPVVSFRLAGDRGYTEFDVSHELRTFGW
QVPAYTMPDNATDVAVLRIVVREGLSADLARALHDDAVTALAALDKVKPGGHFDAQHFAH

Additional Information