Rv3418c (groES)

Current annotations:
- TBCAP: (community-based annotations - see table at bottom of page)
- TBDB: chaperonin
- REFSEQ: co-chaperonin GroES
- PATRIC: Heat shock protein 60 family co-chaperone GroES
- TUBERCULIST: 10 kDa chaperonin GroES (protein CPN10) (protein GroES) (BCG-a heat shock protein) (10 kDa antigen)
- NCBI: 10 kDa chaperonin GroES (protein CPN10) (protein GroES) (BCG-a heat shock protein) (10 kDa antigen)
- updated information (H37Rv4):
  - gene name: groES
  - function:
  - reference:
Type: Not Target
Start: 3836986
End: 3837288
Operon:

Trans-membrane region:
Role: III.B - Chaperones/Heat shock
GO terms:
- GO:0051087 - chaperone binding (Uniprot)
- GO:0051085 - chaperone cofactor-dependent protein refolding (Uniprot)
- GO:0051082 - unfolded protein binding (Uniprot)
- GO:0046872 - metal ion binding (Uniprot)
- GO:0046677 - response to antibiotic (Uniprot)
- GO:0040007 - growth (Uniprot)
- GO:0035375 - zymogen binding (Uniprot)
- GO:0034605 - cellular response to heat (Uniprot)
- GO:0009408 - response to heat (Uniprot)
- GO:0006986 - response to unfolded protein (Uniprot)
- GO:0006457 - protein folding (Uniprot)
- GO:0006355 - regulation of transcription, DNA-templated (Uniprot)
- GO:0005886 - plasma membrane (Uniprot)
- GO:0005829 - cytosol (Uniprot)
- GO:0005737 - cytoplasm (Uniprot)
- GO:0005618 - cell wall (Uniprot)
- GO:0005576 - extracellular region (Uniprot)
- GO:0005524 - ATP binding (Uniprot)
- GO:0005515 - protein binding (Uniprot)
Reaction(s) (based on iSM810 metabolic model):
Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
Orthologs among selected mycobacteria
Protein structure: 1p82, 1p3h, 1p83, 1hx5
Search for Homologs in PDB

Top 10 Homologs in PDB (as of Nov 2020):

PDB	aa ident	species	PDB title
1P83	100%	None	NMR STRUCTURE OF 1-25 FRAGMENT OF MYCOBACTERIUM TUBERCULOSIS CPN10
1P82	100%	None	NMR STRUCTURE OF 1-25 FRAGMENT OF MYCOBACTERIUM TUBERCULOSIS CPN10
1P3H	100%	Mycobacterium tuberculosis	Crystal Structure of the Mycobacterium tuberculosis chaperonin 10 tetradecamer
1HX5	100%	Mycobacterium tuberculosis	Crystal structure of M. tuberculosis chaperonin-10
1LEP	89%	Mycobacterium leprae	THREE-DIMENSIONAL STRUCTURE OF THE IMMUNODOMINANT HEAT-SHOCK PROTEIN CHAPERONIN-10 OF MYCOBACTERIUM LEPRAE
1WNR	60%	Thermus thermophilus	Crystal structure of the Cpn10 from Thermus thermophilus HB8
4V4O	59%	Thermus thermophilus	Crystal Structure of the Chaperonin Complex Cpn60/Cpn10/(ADP)7 from Thermus Thermophilus
5OPX	45%	Escherichia coli (strain K12)	Crystal structure of the GroEL mutant A109C in complex with GroES and ADP BeF2
4PKO	45%	Escherichia coli	Crystal structure of the Football-shaped GroEL-GroES2-(ADPBeFx)14 complex
4PKN	45%	Escherichia coli	Crystal structure of the football-shaped GroEL-GroES2-(ADPBeFx)14 complex containing substrate Rubisco

Links to additional information on groES:
- TBDB (updated)
- Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
- UniProt
- AlphaFold model
- Vulnerability = -13.681 (from Jeremy Rock's lab)
- KEGG - nucleotide and amino acid sequences of gene
- Mycobrowser
- PATRIC
- BioCyc
- Systems Biology

Amino Acid Sequence

VAKVNIKPLEDKILVQANEAETTTASGLVIPDTAKEKPQEGTVVAVGPGRWDEDGEKRIPLDVAEGDTVIYSKYGGTEIKYNGEEYLILSARDVLAVVSK

(Nucleotide sequence available on KEGG)

Additional Information

ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across >100 conditions *new*

Classification	Condition	Strain	Method	Reference	Notes
Too-Short	Sodium Oleate	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: -1.000000; 4 non-insertions in a row out of 4 sites
Too-Short	Lignoceric Acid	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: -1.000000; 4 non-insertions in a row out of 4 sites
Too-Short	Phosphatidylcholine	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: -1.000000; 4 non-insertions in a row out of 4 sites
Too-Short	minimal media + 0.1% glycerol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: -1.000000; 5 non-insertions in a row out of 5 sites
Too-Short	minimal media + 0.01% cholesterol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: -1.000000; 5 non-insertions in a row out of 5 sites
Essential	7H10-glycerol	H37RvMA	TraSH	Sassetti et al. (2003a)
Essential	C57BL/6J mice (8 weeks)	H37RvMA	TraSH	Sassetti et al. (2003b)	Hybridization Ratio: 0.07
Essential	7H09/7H10 + rich media	H37RvMA	MotifHMM	DeJesus et al. (2017)	Fully saturated (14 reps).

TnSeq Data No data currently available.

No TnSeq data currently available for this Target.

RNASeq Data No data currently available.

No RNA-Seq data currently available for this Target.

Metabolomic Profiles No data currently available.

No Metabolomic data currently available for this Target.

Proteomic Data No data currently available.

No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology

BioCyc

Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

Interactions based on ChIPSeq data

Binds To:
- No bindings to other targets were found.
Bound By:
- Rv2827c (-)

Interactions based on ChIPSeq data (Minch et al. 2014)

Binds To:
- No bindings to other targets were found.
Bound By:
- Rv2374c (hrcA) (Direct binding)

Interactions based on TFOE data (Rustad et al. 2014)

Upregulates:
- Does not upregulate other genes.
Upregulated by:
- Not upregulated by other genes.
Downregulates:
- Does not downregulate other genes.
Downregulated by:
- Not downregulated by other genes.

Property	Value	Creator	Evidence	PMID	Comment
Citation	Mycobacterium tuberculosis chaperonin 10 heptamers self-associate through their biologically active loops. MM. Roberts, AR. Coker et al. J. Bacteriol. 2003	chirupolo	IDA	12837792	Structural analysis
Interaction	PhysicalInteraction Rv3417c	chirupolo	IDA		Structural analysis MM. Roberts, AR. Coker et al. Mycobacterium tuberculosis chaperonin 10 heptamers self-associate through their biologically active loops. J. Bacteriol. 2003
Citation	Mycobacterium tuberculosis groE promoter controls the expression of the bicistronic groESL1 operon and shows differential regulation under stress conditions. V. Aravindhan, AJ. Christy et al. FEMS Microbiol. Lett. 2009	chirupolo	IDA	19222581	Structural analysis
Interaction	PhysicalInteraction Rv3417c	chirupolo	IDA		Structural analysis V. Aravindhan, AJ. Christy et al. Mycobacterium tuberculosis groE promoter controls the expression of the bicistronic groESL1 operon and shows differential regulation under stress conditions. FEMS Microbiol. Lett. 2009
Interaction	PhysicalInteraction Rv0440	priti.priety	IDA		Spectrophotometric authors,R. Qamra,SC. Mande Crystal structure of the 65-kilodalton heat shock protein, chaperonin 60.2, of Mycobacterium tuberculosis. J. Bacteriol. 2004
Interaction	PhysicalInteraction Rv0440	priti.priety	IDA		Structural Analysis authors,S. Sinha,S. Arora,K. Kosalai,A. Namane,AS. Pym,ST. Cole Proteome analysis of the plasma membrane of Mycobacterium tuberculosis. Comp. Funct. Genomics 2002
Interaction	PhysicalInteraction Rv0440	priti.priety	IDA		Structural Analysis authors,R. Qamra,SC. Mande Crystal structure of the 65-kilodalton heat shock protein, chaperonin 60.2, of Mycobacterium tuberculosis. J. Bacteriol. 2004
Interaction	PhysicalInteraction Rv0440	priti.priety	IDA		Spectrophotometric authors,S. Sinha,S. Arora,K. Kosalai,A. Namane,AS. Pym,ST. Cole Proteome analysis of the plasma membrane of Mycobacterium tuberculosis. Comp. Funct. Genomics 2002
Interaction	RegulatedBy Rv2710	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. JH. Lee, PC. Karakousis et al. Roles of SigB and SigF in the Mycobacterium tuberculosis sigma factor network. J. Bacteriol. 2008
Interaction	RegulatedBy Rv3678c	yamir.moreno	IDA		One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv3416	yamir.moreno	IDA		One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv3414c	yamir.moreno	IDA		One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv2745c	yamir.moreno	IDA		One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv2021c	yamir.moreno	IDA		One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv0981	yamir.moreno	IDA		One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv0491	yamir.moreno	IDA		One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv2374c	yamir.moreno	TAS		Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008

TB Genome Annotation Portal