TB Genome Annotation Portal

Rv3372 (otsB2)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: trehalose-phosphate phosphatase
  • REFSEQ: trehalose 6-phosphate phosphatase
  • PATRIC: Trehalose-6-phosphate phosphatase (EC 3.1.3.12)
  • TUBERCULIST: Trehalose 6-phosphate phosphatase OtsB2 (trehalose-phosphatase) (TPP)
  • NCBI: Trehalose 6-phosphate phosphatase OtsB2 (trehalose-phosphatase) (TPP)
  • updated information (H37Rv4):
    • gene name: otsB2
    • function:
    • reference:
• Type: Not Target
• Start: 3786314
• End: 3787489
• Operon:


• Trans-membrane region:
  
• Role: III.E - Adaptations and atypical conditions
• GO terms:
  • GO:0046872 - metal ion binding (Uniprot)
  • GO:0040007 - growth (Uniprot)
  • GO:0016787 - hydrolase activity (Uniprot)
  • GO:0016311 - dephosphorylation (Uniprot)
  • GO:0005992 - trehalose biosynthetic process (Uniprot)
  • GO:0005886 - plasma membrane (Uniprot)
  • GO:0005829 - cytosol (Uniprot)
  • GO:0004805 - trehalose-phosphatase activity (Uniprot)
  • GO:0003824 - catalytic activity (Uniprot)
  • GO:0000287 - magnesium ion binding (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
  • TRE6P[c] -> PI[c] + TRE[c]
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure:
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020):
  

  PDB	aa ident	species	PDB title
  5GVX	99%	Mycobacterium tuberculosis	Structural insight into dephosphorylation by Trehalose 6-phosphate Phosphatase (OtsB2) from Mycobacterium Tuberculosis

• Links to additional information on otsB2:
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = -8.636 (from Jeremy Rock's lab)
  • KEGG - nucleotide and amino acid sequences of gene
  • Mycobrowser
  • PATRIC
  • BioCyc
  • Systems Biology

Amino Acid Sequence

VRKLGPVTIDPRRHDAVLFDTTLDATQELVRQLQEVGVGTGVFGSGLDVPIVAAGRLAVRPGRCVVVSAHSAGVTAARESGFALIIGVDRTGCRDALRRD
GADTVVTDLSEVSVRTGDRRMSQLPDALQALGLADGLVARQPAVFFDFDGTLSDIVEDPDAAWLAPGALEALQKLAARCPIAVLSGRDLADVTQRVGLPG
IWYAGSHGFELTAPDGTHHQNDAAAAAIPVLKQAAAELRQQLGPFPGVVVEHKRFGVAVHYRNAARDRVGEVAAAVRTAEQRHALRVTTGREVIELRPDV
DWDKGKTLLWVLDHLPHSGSAPLVPIYLGDDITDEDAFDVVGPHGVPIVVRHTDDGDRATAALFALDSPARVAEFTDRLARQLREAPLRAT

Additional Information

Analysis of Positive Selection in Clinical Isolates *new*

• Analysis of dN/dS (omega) in two collections of Mtb clinical isolates using GenomegaMap (Window model) (see description of methods)
  • Moldova: 2,057 clinical isolates
  • global set: 5,195 clinical isolates from 15 other countries
• In the omega plots, the black line shows the mean estimate of omega (dN/dS) at each codon, and the blue lines are the bounds for the 95% credible interval (95%CI, from MCMC sampling).
• A gene is under significant positive selection if the lower-bound of the 95%CI of omega (lower blue line) exceeds 1.0 at any codon.

	Moldova (2,057)	global set (5,195)
under significant positive selection?	NO	YES
omega peak height (95%CI lower bound)	2.54 (0.67)	2.95 (1.47)
codons under selection		370, 371, 372, 373, 374, 375, 376, 377, 378, 379, 380, 381, 382, 383, 384, 385
omega plots
genetic variants*	link	link
statistics at each codon	link	link