Rv3372 (otsB2)

Current annotations:
- TBCAP: (community-based annotations - see table at bottom of page)
- TBDB: trehalose-phosphate phosphatase
- REFSEQ: trehalose 6-phosphate phosphatase
- PATRIC: Trehalose-6-phosphate phosphatase (EC 3.1.3.12)
- TUBERCULIST: Trehalose 6-phosphate phosphatase OtsB2 (trehalose-phosphatase) (TPP)
- NCBI: Trehalose 6-phosphate phosphatase OtsB2 (trehalose-phosphatase) (TPP)
- updated information (H37Rv4):
  - gene name: otsB2
  - function:
  - reference:
Type: Not Target
Start: 3786314
End: 3787489
Operon:

Trans-membrane region:
Role: III.E - Adaptations and atypical conditions
GO terms:
- GO:0046872 - metal ion binding (Uniprot)
- GO:0040007 - growth (Uniprot)
- GO:0016787 - hydrolase activity (Uniprot)
- GO:0016311 - dephosphorylation (Uniprot)
- GO:0005992 - trehalose biosynthetic process (Uniprot)
- GO:0005886 - plasma membrane (Uniprot)
- GO:0005829 - cytosol (Uniprot)
- GO:0004805 - trehalose-phosphatase activity (Uniprot)
- GO:0003824 - catalytic activity (Uniprot)
- GO:0000287 - magnesium ion binding (Uniprot)
Reaction(s) (based on iSM810 metabolic model):
- TRE6P[c] -> PI[c] + TRE[c]
Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
Orthologs among selected mycobacteria
Protein structure:
Search for Homologs in PDB
Top 10 Homologs in PDB (as of Nov 2020):

PDB aa ident species PDB title

5GVX 99% Mycobacterium tuberculosis Structural insight into dephosphorylation by Trehalose 6-phosphate Phosphatase (OtsB2) from Mycobacterium Tuberculosis
Links to additional information on otsB2:
- TBDB (updated)
- Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
- UniProt
- AlphaFold model
- Vulnerability = -8.636 (from Jeremy Rock's lab)
- KEGG - nucleotide and amino acid sequences of gene
- Mycobrowser
- PATRIC
- BioCyc
- Systems Biology

PDB	aa ident	species	PDB title
5GVX	99%	Mycobacterium tuberculosis	Structural insight into dephosphorylation by Trehalose 6-phosphate Phosphatase (OtsB2) from Mycobacterium Tuberculosis

Amino Acid Sequence

VRKLGPVTIDPRRHDAVLFDTTLDATQELVRQLQEVGVGTGVFGSGLDVPIVAAGRLAVRPGRCVVVSAHSAGVTAARESGFALIIGVDRTGCRDALRRD
GADTVVTDLSEVSVRTGDRRMSQLPDALQALGLADGLVARQPAVFFDFDGTLSDIVEDPDAAWLAPGALEALQKLAARCPIAVLSGRDLADVTQRVGLPG
IWYAGSHGFELTAPDGTHHQNDAAAAAIPVLKQAAAELRQQLGPFPGVVVEHKRFGVAVHYRNAARDRVGEVAAAVRTAEQRHALRVTTGREVIELRPDV
DWDKGKTLLWVLDHLPHSGSAPLVPIYLGDDITDEDAFDVVGPHGVPIVVRHTDDGDRATAALFALDSPARVAEFTDRLARQLREAPLRAT

(Nucleotide sequence available on KEGG)

Additional Information

ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across >100 conditions *new*

Classification	Condition	Strain	Method	Reference	Notes
Uncertain	Sodium Oleate	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.984850; 9 non-insertions in a row out of 9 sites
Essential	Lignoceric Acid	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.998150; 9 non-insertions in a row out of 9 sites
Essential	Phosphatidylcholine	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.999150; 9 non-insertions in a row out of 9 sites
Essential	minimal media + 0.1% glycerol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 0.997800; 9 non-insertions in a row out of 9 sites
Essential	minimal media + 0.01% cholesterol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 0.997200; 9 non-insertions in a row out of 9 sites
Essential	7H10-glycerol	H37RvMA	TraSH	Sassetti et al. (2003a)
Essential	C57BL/6J mice (8 weeks)	H37RvMA	TraSH	Sassetti et al. (2003b)	Hybridization Ratio: 0.12
Essential	7H09/7H10 + rich media	H37RvMA	MotifHMM	DeJesus et al. (2017)	Fully saturated (14 reps).

TnSeq Data No data currently available.

No TnSeq data currently available for this Target.

RNASeq Data No data currently available.

No RNA-Seq data currently available for this Target.

Metabolomic Profiles No data currently available.

No Metabolomic data currently available for this Target.

Proteomic Data No data currently available.

No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology

BioCyc

Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

Interactions based on ChIPSeq data

Binds To:
- No bindings to other targets were found.
Bound By:
- Rv0576 (-)
- Rv0818 (-)

Interactions based on ChIPSeq data (Minch et al. 2014)

Binds To:
- No bindings to other targets were found.
Bound By:
- No bindings to other targets were found.

Interactions based on TFOE data (Rustad et al. 2014)

Upregulates:
- Does not upregulate other genes.
Upregulated by:
- Rv0818 (-)
Downregulates:
- Does not downregulate other genes.
Downregulated by:
- Rv0576 (-)

Property	Value	Creator	Evidence	PMID	Comment
Term	EC:3.1.3.12 Trehalose-phosphatase. - ISS	njamshidi	ISS	10658666	PMID: 10658666 KA. De Smet, A. Weston et al. Three pathways for trehalose biosynthesis in mycobacteria. Microbiology (Reading, Engl.) 2000
Term	TBRXN:TRE6PP trehalose-phosphatase - ISS	njamshidi	ISS	10658666	PMID: 10658666 KA. De Smet, A. Weston et al. Three pathways for trehalose biosynthesis in mycobacteria. Microbiology (Reading, Engl.) 2000
Citation	Three pathways for trehalose biosynthesis in mycobacteria. KA. De Smet, A. Weston et al. Microbiology (Reading, Engl.) 2000	njamshidi	IDA	10658666	PMID: 10658666
Term	EC:3.1.3.12 Trehalose-phosphatase. - IDA	njamshidi	IDA	10658666	PMID: 10658666 KA. De Smet, A. Weston et al. Three pathways for trehalose biosynthesis in mycobacteria. Microbiology (Reading, Engl.) 2000
Term	TBRXN:TRE6PP trehalose-phosphatase - IDA	njamshidi	IDA	10658666	PMID: 10658666 KA. De Smet, A. Weston et al. Three pathways for trehalose biosynthesis in mycobacteria. Microbiology (Reading, Engl.) 2000
Citation	Three pathways for trehalose biosynthesis in mycobacteria. KA. De Smet, A. Weston et al. Microbiology (Reading, Engl.) 2000	njamshidi	ISS	10658666	PMID: 10658666
Name	Trehalose-6P-phosphatase, homolog to N-term w/otsB core of Rv2006: INVOLVED IN TREHALOSE BIOSYNTHESIS FROM GLUCOSE 6-PHOSPHATE AND UDP-GLUCOSE	mjackson	ISS		Trehalose biosynthesis
Name	Trehalose-6P-phosphatase, homolog to N-term w/otsB core of Rv2006: INVOLVED IN TREHALOSE BIOSYNTHESIS FROM GLUCOSE 6-PHOSPHATE AND UDP-GLUCOSE	mjackson	IMP		Trehalose biosynthesis
Citation	Cloning and expression of the trehalose-phosphate phosphatase of Mycobacterium tuberculosis: comparison to the enzyme from Mycobacterium smegmatis. VK. Edavana, I. Pastuszak et al. Arch. Biochem. Biophys. 2004	extern:JZUCKER		15158675	Assay of protein purified to homogeneity from a heterlogous host
Term	EC:3.1.3.12 Trehalose-phosphatase. - NR	extern:JZUCKER	NR		Assay of protein purified to homogeneity from a heterlogous host VK. Edavana, I. Pastuszak et al. Cloning and expression of the trehalose-phosphate phosphatase of Mycobacterium tuberculosis: comparison to the enzyme from Mycobacterium smegmatis. Arch. Biochem. Biophys. 2004

TB Genome Annotation Portal