Rv3367 (PE_PGRS51)

Current annotations:
- TBCAP: (community-based annotations - see table at bottom of page)
- TBDB: PE-PGRS family protein
- REFSEQ: PE-PGRS family protein
- PATRIC: PE_PGRS family protein
- TUBERCULIST: PE-PGRS family protein PE_PGRS51
- NCBI: PE-PGRS family protein PE_PGRS51
- updated information (H37Rv4):
  - gene name: PE_PGRS51
  - function:
  - reference:
Type: Not Target
Start: 3778568
End: 3780334
Operon:

Trans-membrane region:
Role: IV.C.1.b - PE_PGRS subfamily
GO terms:
- No terms assigned.
Reaction(s) (based on iSM810 metabolic model):
Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
Orthologs among selected mycobacteria
Protein structure:
Search for Homologs in PDB
Top 10 Homologs in PDB (as of Nov 2020):

PDB aa ident species PDB title

5XFS 51% Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) Crystal structure of PE8-PPE15 in complex with EspG5 from M. tuberculosis
Links to additional information on PE_PGRS51:
- TBDB (updated)
- KEGG - nucleotide and amino acid sequences of gene
- Mycobrowser
- PATRIC
- BioCyc
- Systems Biology

PDB	aa ident	species	PDB title
5XFS	51%	Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)	Crystal structure of PE8-PPE15 in complex with EspG5 from M. tuberculosis

Amino Acid Sequence

MSFVVAVPEALAAAASDVANIGSALSAANAAAAAGTTGLLAAGADEVSAALASLFSGHAVSYQQVAAQATALHDQFVQALTGAGGSYALTEAANVQQNLL
NAINAPTQALLGRPLIGDGAVGTASSPDGQDGGLLFGNGGAGYNSAATPGMAGGNGGNAGLIGNGGTGGSGGAGAAGGAGGSGGWLYGNGGNGGIGGNAI
VAGGAGGNGGAGGAAGLWGSGGSGGQGGNGLTGNDGVNPAPVTNPALNGAAGDSNIEPQTSVLIGTQGGDGTPGGAGVNGGNGGAGGDANGNPANTSIAN
AGAGGNGAAGGDGGANGGAGGAGGQAASAGSSVGGDGGNGGAGGTGTNGHAGGAGGAGGAGGRGGWLVGNGGNGGNGAAGGNGAIGGTGGAGGVPANQGG
NSALGTQPVGGDGGDGGNGGTGGTGGRGGDGGSGGAGGASGWLMGNGGNGGNGGTGGSGGVGGNGGIGGDGAGGGNATSTSSIPFDAHGGNGGAGGDAGH
GGTGGDGGDGGHAGTGGRGGLLAGQHANSGNGGGGGTGGAGGTHGTPGSGNAGGTGTGNADSTNGGPGSDGLGGDAFNGSRGTDGNPG

(Nucleotide sequence available on KEGG)

Additional Information

ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across >100 conditions *new*

Classification	Condition	Strain	Method	Reference	Notes
Uncertain	Sodium Oleate	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.466250; 7 non-insertions in a row out of 23 sites
Non-Essential	Lignoceric Acid	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.000000; 3 non-insertions in a row out of 23 sites
Non-Essential	Phosphatidylcholine	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.000000; 3 non-insertions in a row out of 23 sites
Non-Essential	minimal media + 0.1% glycerol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 0.000000; 2 non-insertions in a row out of 24 sites
Non-Essential	minimal media + 0.01% cholesterol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 0.000000; 3 non-insertions in a row out of 24 sites
Non-Essential	7H10-glycerol	H37RvMA	TraSH	Sassetti et al. (2003a)
Non-Essential	C57BL/6J mice (8 weeks)	H37RvMA	TraSH	Sassetti et al. (2003b)	Hybridization Ratio: 3.66
Non-Essential	7H09/7H10 + rich media	H37RvMA	MotifHMM	DeJesus et al. (2017)	Fully saturated (14 reps).

TnSeq Data No data currently available.

No TnSeq data currently available for this Target.

RNASeq Data No data currently available.

No RNA-Seq data currently available for this Target.

Metabolomic Profiles No data currently available.

No Metabolomic data currently available for this Target.

Proteomic Data No data currently available.

No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology

BioCyc

Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

Interactions based on ChIPSeq data

Binds To:
- No bindings to other targets were found.
Bound By:
- Rv3416 (whiB3)

Interactions based on ChIPSeq data (Minch et al. 2014)

Binds To:
- No bindings to other targets were found.
Bound By:
- No bindings to other targets were found.

Interactions based on TFOE data (Rustad et al. 2014)

Upregulates:
- Does not upregulate other genes.
Upregulated by:
- Rv3416 (whiB3)
Downregulates:
- Does not downregulate other genes.
Downregulated by:
- Not downregulated by other genes.

Property	Value	Creator	Evidence	PMID	Comment
Citation	The interaction topology of Mycobacterium tuberculosis genes response to capreomycin and novel clues for more drug targets. authors,F. Zheng,J. Xie J. Cell. Biochem. 2011	jlew		21678479	promising new capreomycin target. We employed the data mining to construct an interaction topology of M. tuberculosis genes response to capreomycin. Dampening the virulence factors and respiratory of M. tuberculosis might be the new targets of CPM beyond Rv1364c, pe_pgrs38, pe_pgrs51 which are the salient nodes of the network and represent most promising new capreomycin targets meriting further exploration.
Citation	Variable expression patterns of Mycobacterium tuberculosis PE_PGRS genes: evidence that PE_PGRS16 and PE_PGRS26 are inversely regulated in vivo. V. Dheenadhayalan, G. Delogu et al. J. Bacteriol. 2006	jlew		16672626	Reasonably expressed in log-phase, nutrient-rich culture, showed little or no expression under all other growth conditions examined. Evaluation of expression of 16 PE_PGRS genes present in Mycobacterium tuberculosis under various growth conditions

TB Genome Annotation Portal