TB Genome Annotation Portal

Rv3361c (-)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: hypothetical protein
  • REFSEQ: hypothetical protein
  • PATRIC: pentapeptide repeat family protein
  • TUBERCULIST: Conserved protein
  • NCBI: hypothetical protein
  • updated information (H37Rv4):
    • gene name: mfpA
    • function: pentapeptide repeat, mimics DNA; confers fluoroquinoline resistance by binding to GyrAB
    • reference: Hedge (2005) PMID: 15933203
• Type: Not Target
• Start: 3773016
• End: 3773567
• Operon:


• Trans-membrane region:
  
• Role: V - Conserved hypotheticals
• GO terms:
  • No terms assigned.
• Reaction(s) (based on iSM810 metabolic model):
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure: 2bm4, 2bm5, 2bm6, 2bm7
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020):
  

  PDB	aa ident	species	PDB title
  2BM7	99%	MYCOBACTERIUM TUBERCULOSIS	The Structure of MfpA (Rv3361c, P3221 Crystal form). The Pentapeptide Repeat Protein from Mycobacterium tuberculosis Folds as A Right- handed Quadrilateral Beta-helix.
  2BM6	99%	MYCOBACTERIUM TUBERCULOSIS	The Structure of MfpA (Rv3361c, C2221 Crystal form). The Pentapeptide Repeat Protein from Mycobacterium tuberculosis Folds as A Right- handed Quadrilateral Beta-helix.
  2BM5	99%	MYCOBACTERIUM TUBERCULOSIS	The Structure of MfpA (Rv3361c, P21 Crystal form). The Pentapeptide Repeat Protein from Mycobacterium tuberculosis Folds as A Right- handed Quadrilateral Beta-helix.
  2BM4	99%	MYCOBACTERIUM TUBERCULOSIS	The Structure of MfpA (Rv3361c, C2 Crystal form). The Pentapeptide Repeat Protein from Mycobacterium tuberculosis Folds as A Right- handed Quadrilateral Beta-helix.
  5DNS	50%	synthetic construct	t1428 loop variant in P3221
  5DN0	50%	synthetic construct	t1555 loop variant
  5DQA	49%	synthetic construct	t3284 loop variant of beta1
  5DZB	48%	synthetic construct	6beta1
  4YFO	48%	synthetic construct	beta1_ex1
  5DRA	45%	synthetic construct	t3284 loop variant of beta1

• Links to additional information on Rv3361c:
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = -0.253 (from Jeremy Rock's lab)
  • KEGG - nucleotide and amino acid sequences of gene
  • Mycobrowser
  • PATRIC
  • BioCyc
  • Systems Biology

Amino Acid Sequence

LQQWVDCEFTGRDFRDEDLSRLHTERAMFSECDFSGVNLAESQHRGSAFRNCTFERTTLWHSTFAQCSMLGSVFVACRLRPLTLDDVDFTLAVLGGNDLR
GLNLTGCRLRETSLVDTDLRKCVLRGADLSGARTTGARLDDADLRGATVDPVLWRTASLVGARVDVDQAVAFAAAHGLCLAGG

Additional Information

MfpA - pentapeptide repeat, mimics DNA, possibly confers FQ resistance by binding to GyrAB
Hedge et al (2005). A Fluoroquinolone Resistance Protein from Mycobacterium tuberculosis That Mimics DNA. Science. http://www.sciencemag.org/content/308/5727/1480.long