TB Genome Annotation Portal

Rv3334 (-)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: transcriptional regulator merR-family
  • REFSEQ: MerR family transcriptional regulator
  • PATRIC: Mercuric resistance operon regulatory protein
  • TUBERCULIST: Probable transcriptional regulatory protein (probably MerR-family)
  • NCBI: Probable transcriptional regulatory protein (probably MerR-family)
  • updated information (H37Rv4):
    • gene name: -
    • function:
    • reference:
• Type: Not Target
• Start: 3721257
• End: 3721697
• Operon:


• Trans-membrane region:
  
• Role: I.J.1 - Repressors/activators
• GO terms:
  • GO:0019217 - regulation of fatty acid metabolic process (Uniprot)
  • GO:0006355 - regulation of transcription, DNA-templated (Uniprot)
  • GO:0003677 - DNA binding (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure:
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020):
  

  PDB	aa ident	species	PDB title
  5GPE	40%	Cupriavidus metallidurans CH34	Crystal structure of the transcription regulator PbrR691 from Ralstonia metallidurans CH34 in complex with Lead(II)
  6JYW	37%	Pseudomonas putida	Crystal structure of the transcription regulator CadR N81M mutant from P. putida in complex with Cadmium(II) and DNA
  6JNI	37%	Pseudomonas putida	Crystal structure of the transcriptional regulator CadR from P. putida in complex with Zinc(II) and DNA
  6JGX	37%	Pseudomonas putida	Crystal structure of the transcriptional regulator CadR from P. putida in complex with Cadmium(II) and DNA
  6JGW	37%	Pseudomonas putida	Crystal structure of the transcriptional regulator CadR from P. putida in complex with DNA
  6JGV	37%	Pseudomonas putida	Crystal structure of the transcriptional regulator CadR from P. putida
  6JGF	37%	Pseudomonas putida	Crystal structure of Se-Met CadR from P. putida with a 21 residue C-terminal truncation
  4UA2	37%	Bacillus megaterium	Crystal structure of dual function transcriptional regulator MerR from Bacillus megaterium MB1
  4UA1	37%	Bacillus megaterium	Crystal structure of dual function transcriptional regulator MerR form Bacillus megaterium MB1 in complex with mercury (II) ion

• Links to additional information on Rv3334:
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = 0.619 (from Jeremy Rock's lab)
  • KEGG - nucleotide and amino acid sequences of gene
  • Mycobrowser
  • PATRIC
  • BioCyc
  • Systems Biology

Amino Acid Sequence

MKISEVAALTNTSTKTLRFYENSGLLPPPARTASGYRNYGPEIVDRLRFIHRGQAAGLALQEVRQILAIHDRGEAPCAHVRQLLSTRIDEVRAQIAELIA
LEGHLQTLLDHASYGPPTEHDHSTVCWILESDLDEPTAIEVSDIHA

Additional Information