TB Genome Annotation Portal

Rv3285 (accA3)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: acetyl-/propionyl-coenzyme A carboxylase alpha chain
  • REFSEQ: bifunctional acetyl-/propionyl-coenzyme A carboxylase subunit alpha
  • PATRIC: Biotin carboxylase of acetyl-CoA carboxylase (EC 6.3.4.14) / Biotin carboxyl carrier protein of acetyl-CoA carboxylase
  • TUBERCULIST: Probable bifunctional protein acetyl-/propionyl-coenzyme A carboxylase (alpha chain) AccA3: biotin carboxylase + biotin carboxyl carrier protein (BCCP)
  • NCBI: Probable bifunctional protein acetyl-/propionyl-coenzyme A carboxylase (alpha chain) AccA3: biotin carboxylase + biotin carboxyl carrier protein (BCCP)
  • updated information (H37Rv4):
    • gene name: accA3
    • function:
    • reference:
• Coordinates in H37Rv: 3666357 - 3668159
• Gene length: 1803 bp (with stop codon), 600 aa (without stop codon)
• Operon:


• Trans-membrane region:
  
• Role: I.H.1 - Synthesis of fatty and mycolic acids
• GO terms:
  • GO:0046872 - metal ion binding (Uniprot)
  • GO:0040007 - growth (Uniprot)
  • GO:0015977 - carbon fixation (Uniprot)
  • GO:0009317 - acetyl-CoA carboxylase complex (Uniprot)
  • GO:0005886 - plasma membrane (Uniprot)
  • GO:0005618 - cell wall (Uniprot)
  • GO:0005524 - ATP binding (Uniprot)
  • GO:0005515 - protein binding (Uniprot)
  • GO:0004658 - propionyl-CoA carboxylase activity (Uniprot)
  • GO:0003989 - acetyl-CoA carboxylase activity (Uniprot)
  • GO:0000166 - nucleotide binding (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
  • BIOTIN_CO2[c] + HEXACOSANOYL_COA[c] -> BIOTIN[c] + HEXACOSANOYL_COA_CO2[c]
  • ATP[c] + HCO3[c] + BIOTIN_BCCP[c] -> ADP[c] + PI[c] + BIOTIN_CO2[c]
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure:
• Search for Latest Homologs in PDB
• Top 10 Homologs in PDB (as of Apr 2026):
  

  PDB	aa ident	species	PDB title
  5MLK	99%	Mycobacterium tuberculosis H37Rv	Biotin dependent carboxylase AccA3 dimer from Mycobacterium tuberculosis (Rv3285)
  9YX5	85%	Mycolicibacterium smegmatis MC2 155	Structure of the long chain acyl-CoA carboxylase complex from Mycobacterium smegmatis with MSMEG_0435-MSMEG_0436 bound
  9YX4	85%	Mycolicibacterium smegmatis MC2 155	Structure of the long chain acyl-CoA carboxylase complex from Mycobacterium smegmatis with ATP, bicarbonate, arachidoyl-CoA, and propionyl-CoA
  9YX2	85%	Mycolicibacterium smegmatis MC2 155	Structure of the long chain acyl-CoA carboxylase complex from Mycobacterium smegmatis with ATP, bicarbonate, and propionyl-CoA
  9YX1	85%	Mycolicibacterium smegmatis MC2 155	Structure of the long chain acyl-CoA carboxylase complex from Mycobacterium smegmatis
  8HZ4	54%	Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl)	The tetrameric structure of biotin carboxylase from Chloroflexus aurantiacus in complex with bicarbonate
  9EB8	50%	Ankistrodesmus falcatus	Crystal Structure of Biotin Carboxylase from Ankistrodesmus in Complex with ADP
  9EB7	50%	Ankistrodesmus falcatus	Crystal Structure of Biotin Carboxylase from Ankistrodesmus
  9AAL	48%	None	Pennycress biotin carboxylase tetramer integrative model
  8HZ5	47%	Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl)	The homodimer of a biotin carboxylase isoform from chloroflexus aurantiacus

• Links to additional information on accA3:
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = -13.378 (from Jeremy Rock's lab)
  • KEGG - nucleotide and amino acid sequences of gene
  • Mycobrowser
  • PATRIC
  • BioCyc
  • Systems Biology

Amino Acid Sequence

VASHAGSRIARISKVLVANRGEIAVRVIRAARDAGLPSVAVYAEPDAESPHVRLADEAFALGGQTSAESYLDFAKILDAAAKSGANAIHPGYGFLAENAD
FAQAVIDAGLIWIGPSPQSIRDLGDKVTARHIAARAQAPLVPGTPDPVKGADEVVAFAEEYGLPIAIKAAHGGGGKGMKVARTIDEIPELYESAVREATA
AFGRGECYVERYLDKPRHVEAQVIADQHGNVVVAGTRDCSLQRRYQKLVEEAPAPFLTDFQRKEIHDSAKRICKEAHYHGAGTVEYLVGQDGLISFLEVN
TRLQVEHPVTEETAGIDLVLQQFRIANGEKLDITEDPTPRGHAIEFRINGEDAGRNFLPAPGPVTKFHPPSGPGVRVDSGVETGSVIGGQFDSMLAKLIV
HGADRAEALARARRALNEFGVEGLATVIPFHRAVVSDPAFIGDANGFSVHTRWIETEWNNTIEPFTDGEPLDEDARPRQKVVVEIDGRRVEVSLPADLAL
SNGGGCDPVGVIRRKPKPRKRGAHTGAAASGDAVTAPMQGTVVKFAVEEGQEVVAGDLVVVLEAMKMENPVTAHKDGTITGLAVEAGAAITQGTVLAEIK

Additional Information

Analysis of Positive Selection in Clinical Isolates *new*

• data from Culviner et al (2025) (55,259 Mtb clinical isolates)
  • overall pN/pS for Rv3285: 0.393215112
  • lineage-specific pN/pS in L1: 0.365735524
  • lineage-specific pN/pS in L2: 0.348198075
  • lineage-specific pN/pS in L3: 0.352461725
  • lineage-specific pN/pS in L4: 0.434200381

• Analysis of dN/dS (omega) in a global collection of 10k Mtb clinical isolates using GenomegaMap (Window model)
• clinical isolates collection: global set of 10,626 Mtb genomes
• In the omega plots, the black line shows the mean estimate of omega (dN/dS) at each codon, and the blue lines are the bounds for the 95% credible interval (95%CI, from MCMC sampling).
• A gene is under significant positive selection if the lower-bound of the 95%CI of omega (lower blue line) exceeds 1.0 at any codon.

	global set of 10,626 Mtb clinical isolates
under significant positive selection?	NO
omega peak height (95%CI lower bound)	1.23 (0.52)
codons under selection
omega plots
genetic variants*	link