TB Genome Annotation Portal

Rv3279c (birA)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: biotin-[acetyl-CoA-carboxylase] ligase
  • REFSEQ: biotin--protein ligase
  • PATRIC: Biotin-protein ligase (EC 6.3.4.15)
  • TUBERCULIST: Possible bifunctional protein BirA: biotin operon repressor + biotin--[acetyl-CoA-carboxylase] synthetase (biotin--protein ligase)
  • NCBI: Possible bifunctional protein BirA: biotin operon repressor + biotin--[acetyl-CoA-carboxylase] synthetase (biotin--protein ligase)
  • updated information (H37Rv4):
    • gene name: birA
    • function:
    • reference:
• Type: Not Target
• Start: 3661212
• End: 3662012
• Operon:


• Trans-membrane region:
  
• Role: I.G.1 - Biotin
• GO terms:
  • GO:0042803 - protein homodimerization activity (Uniprot)
  • GO:0032991 - protein-containing complex (Uniprot)
  • GO:0016874 - ligase activity (Uniprot)
  • GO:0009374 - biotin binding (Uniprot)
  • GO:0008284 - positive regulation of cell proliferation (Uniprot)
  • GO:0006464 - cellular protein modification process (Uniprot)
  • GO:0004077 - biotin-[acetyl-CoA-carboxylase] ligase activity (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
  • ATP[c] + BIOTIN[c] -> PPI[c] + AMP[c] + BIOTIN_BCCP[c]
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure: 3l1a, 2cgh, 3l2z, 3rux
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020):
  

  PDB	aa ident	species	PDB title
  4XU3	100%	Mycobacterium tuberculosis	Mycobacterium tuberculosis biotin ligase complexed with bisubstrate inhibitor 90 that has an acyclic ether in place of the ribose
  4XU2	100%	Mycobacterium tuberculosis	Mycobacterium tuberculosis biotin ligase complexed with bisubstrate inhibitor 87 with a 3'deoxy ribose
  4XU1	100%	Mycobacterium tuberculosis	Mycobacterium tuberculosis biotin ligase complexed with bisubstrate inhibitor 82 that incorporates a morpholine in place of the ribose
  4XU0	100%	Mycobacterium tuberculosis	Mycobacterium tuberculosis biotin ligase complexed with bisubstrate inhibitor 73 that has a 2'-methyl on the ribose
  4XTZ	100%	Mycobacterium tuberculosis	Mycobacterium tuberculosis biotin ligase complexed with bisubstrate inhibitor 69 that has a fluorine in place of the ribose 2'OH
  4XTY	100%	Mycobacterium tuberculosis	Mycobacterium tuberculosis biotin ligase complexed with bisubstrate inhibitor 63 with Fluorine in place of 2'OH
  4XTX	100%	Mycobacterium tuberculosis	Mycobacterium tuberculosis biotin ligase complexed with bisubstrate inhibitor 57 with azide in place of ribose 2'OH
  4XTW	100%	Mycobacterium tuberculosis	Mycobacterium tuberculosis biotin ligase complexed with bisubstrate inhibitor 46 with azide in place of 2'OH
  4XTV	100%	Mycobacterium tuberculosis	Mycobacterium tuberculosis biotin ligase complexed with bisubstrate inhibitor 36 (N-({[(1R,3S)-3-(6-amino-9H-purin-9-yl)cyclopentyl]methyl}sulfamoyl)-5-[(3aS,4S,6aR)-2-oxohexahydro-1H-thieno[3,4-d]imidazol-4-yl]pentanamide)
  4XTU	100%	Mycobacterium tuberculosis	Mycobacterium tuberculosis biotin ligase complexed with bisubstrate inhibitor (N-({[(1R,2S,3R,4R)-4-(6-amino-9H-purin-9-yl)-2,3-dihydroxycyclopentyl]methyl}sulfamoyl)-5-[(3aS,4S,6aR)-2-oxohexahydro-1H-thieno[3,4-d]imidazol-4-yl]pentanamide)

• Links to additional information on birA:
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = -0.168 (from Jeremy Rock's lab)
  • KEGG - nucleotide and amino acid sequences of gene
  • Mycobrowser
  • PATRIC
  • BioCyc
  • Systems Biology

Amino Acid Sequence

VTDRDRLRPPLDERSLRDQLIGAGSGWRQLDVVAQTGSTNADLLARAASGADIDGVVLIAEHQTAGRGRHGRGWAATARAQIILSVGVRVVDVPVQAWGW
LSLAAGLAVLDSVAPLIAVPPAETGLKWPNDVLARGGKLAGILAEVAQPFVVLGVGLNVTQAPEEVDPDATSLLDLGVAAPDRNRIASRLLRELEARIIQ
WRNANPQLAADYRARSLTIGSRVRVELPGGQDVVGIARDIDDQGRLCLDVGGRTVVVSAGDVVHLR

Additional Information