Rv3265c (wbbL1)

Current annotations:
- TBCAP: (community-based annotations - see table at bottom of page)
- TBDB: dTDP-Rha:alpha-D-GlcNAc-pyrophosphate polyprenol alpha-3-L-rhamnosyltransferase
- REFSEQ: dTDP-RHA:A-D-GlcNAc-diphosphoryl polyprenol
- PATRIC: dTDP-Rha:A-D-GlcNAc-diphosphoryl polyprenol A-3-L-rhamnosyl transferase WbbL
- TUBERCULIST: dTDP-RHA:a-D-GlcNAc-diphosphoryl polyprenol a-3-L-rhamnosyl transferase WbbL1 (alpha-L-rhamnose-(1->3)-alpha-D-GlcNAc(1->P)-P-decaprenyl)
- NCBI: dTDP-RHA:a-D-GlcNAc-diphosphoryl polyprenol,a-3-L-rhamnosyl transferase WbbL1 (alpha-L-rhamnose-(1->3)-alpha-D-GlcNAc(1->P)-P- decaprenyl)
- updated information (H37Rv4):
  - gene name: wbbL1
  - function:
  - reference:
Type: Not Target
Start: 3645979
End: 3646884
Operon:

Trans-membrane region:
Role: I.C.3 - Sugar nucleotides
GO terms:
- GO:0102096 - decaprenyl-N-acetyl-alpha-D-glucosaminyl-pyrophosphate:dTDP-alpha-L-rhamnose rhamnosyltransferase activity (Uniprot)
- GO:0045226 - extracellular polysaccharide biosynthetic process (Uniprot)
- GO:0040007 - growth (Uniprot)
- GO:0016758 - transferase activity, transferring hexosyl groups (Uniprot)
- GO:0016757 - transferase activity, transferring glycosyl groups (Uniprot)
- GO:0016740 - transferase activity (Uniprot)
- GO:0005886 - plasma membrane (Uniprot)
Reaction(s) (based on iSM810 metabolic model):
- DTDPRHAM[c] + NAGDPP[c] -> DTDP[c] + RHAMNAGDPP[c]
Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
Orthologs among selected mycobacteria
Protein structure:
Search for Homologs in PDB
Top 10 Homologs in PDB (as of Nov 2020): (none with >35% aa id)
Links to additional information on wbbL1:
- TBDB (updated)
- Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
- UniProt
- AlphaFold model
- Vulnerability = -5.902 (from Jeremy Rock's lab)
- KEGG - nucleotide and amino acid sequences of gene
- Mycobrowser
- PATRIC
- BioCyc
- Systems Biology

Amino Acid Sequence

VVAVTYSPGPHLERFLASLSLATERPVSVLLADNGSTDGTPQAAVQRYPNVRLLPTGANLGYGTAVNRTIAQLGEMAGDAGEPWVDDWVIVANPDVQWGP
GSIDALLDAASRWPRAGALGPLIRDPDGSVYPSARQMPSLIRGGMHAVLGPFWPRNPWTTAYRQERLEPSERPVGWLSGSCLLVRRSAFGQVGGFDERYF
MYMEDVDLGDRLGKAGWLSVYVPSAEVLHHKAHSTGRDPASHLAAHHKSTYIFLADRHSGWWRAPLRWTLRGSLALRSHLMVRSSLRRSRRRKLKLVEGR
H

(Nucleotide sequence available on KEGG)

Additional Information

ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across >100 conditions *new*

Classification	Condition	Strain	Method	Reference	Notes
Essential	Sodium Oleate	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.999850; 16 non-insertions in a row out of 17 sites
Essential	Lignoceric Acid	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 1.000000; 16 non-insertions in a row out of 17 sites
Essential	Phosphatidylcholine	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 1.000000; 16 non-insertions in a row out of 17 sites
Essential	minimal media + 0.1% glycerol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 0.999950; 16 non-insertions in a row out of 17 sites
Essential	minimal media + 0.01% cholesterol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 1.000000; 16 non-insertions in a row out of 17 sites
Essential	7H10-glycerol	H37RvMA	TraSH	Sassetti et al. (2003a)
Essential	C57BL/6J mice (8 weeks)	H37RvMA	TraSH	Sassetti et al. (2003b)	Hybridization Ratio: 0.06
Essential	7H09/7H10 + rich media	H37RvMA	MotifHMM	DeJesus et al. (2017)	Fully saturated (14 reps).

TnSeq Data No data currently available.

No TnSeq data currently available for this Target.

RNASeq Data No data currently available.

No RNA-Seq data currently available for this Target.

Metabolomic Profiles No data currently available.

No Metabolomic data currently available for this Target.

Proteomic Data No data currently available.

No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology

BioCyc

Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

Interactions based on ChIPSeq data

RNA processing and modification

Energy production and conversion

Chromatin structure and dynamics

Amino acid transport and metabolism

Cell cycle control, cell division, chromosome partitioning

Carbohydrate transport and metabolism

Nucleotide transport and metabolism

Lipid transport and metabolism

Coenzyme transport and metabolism

Transcription

Translation, ribosomal structure and biogenesis

Cell wall/membrane/envelope biogenesis

Replication, recombination and repair

Posttranslational modification, protein turnover, chaperones

Cell motility

Secondary metabolites biosynthesis, transport and catabolism

Inorganic ion transport and metabolism

Function unknown

General function prediction only

Intracellular trafficking, secretion, and vesicular transport

Signal transduction mechanisms

Extracellular structures

Defense mechanisms

Nuclear structure

Cytoskeleton

BioCyc Co-regulated genes based on gene expression profiling (Systems Biology, Inferelator Network)

Differentially expressed as result of RNASeq in glycerol environment (Only top 20 genes shown sorted by log fold change with p_adj 0.05).

Conditionally essential as result of TNSeq (Only top 20 genes shown sorted by log fold change with p_adj 0.05).

BioCyc Transcription factor binding based on ChIP-Seq (Systems Biology)

Binds To:
- No bindings to other targets were found.
Bound By:
- No bindings from other targets were found.

Interactions based on ChIPSeq data (Minch et al. 2014)

Binds To:
- No bindings to other targets were found.
Bound By:
- Rv3249c (-) (Direct binding)

Interactions based on TFOE data (Rustad et al. 2014)

Upregulates:
- Does not upregulate other genes.
Upregulated by:
- Not upregulated by other genes.
Downregulates:
- Does not downregulate other genes.
Downregulated by:
- Not downregulated by other genes.

Property	Value	Creator	Evidence	PMID	Comment
Symbol	wbbL	mjackson	IDA		Rhamnosyltransferase
Name	dTDP-Rha:alpha-D-GlcNAc-pyrophosphate polyprenol, alpha-3-L-rhamnosyltransferase which attaches a rhamnosyl residues to GlcNAc-P-P-decaprenyl to form Rha-GlcNAc-P-P-decaprenyl	mjackson	IDA		Rhamnosyltransferase
Symbol	wbbL	mmcneil			dTDP-Rha:alpha-D-GlcNAc-pyrophosphate polyprenol, alpha-3-L-rhamnosyltransferase which attaches a rhamnosyl residues to GlcNAc-P-P-decaprenyl to form Rha-GlcNAc-P-P-decaprenyl; enzymatic evidence authors,AE. Grzegorzewicz,Y. Ma,V. Jones,D. Crick,A. Liav,MR. McNeil Development of a microtitre plate-based assay for lipid-linked glycosyltransferase products using the mycobacterial cell wall rhamnosyltransferase WbbL. Microbiology (Reading, Engl.) 2008
Citation	Development of a microtitre plate-based assay for lipid-linked glycosyltransferase products using the mycobacterial cell wall rhamnosyltransferase WbbL. authors,AE. Grzegorzewicz,Y. Ma,V. Jones,D. Crick,A. Liav,MR. McNeil Microbiology (Reading, Engl.) 2008	mmcneil		19047740	dTDP-Rha:alpha-D-GlcNAc-pyrophosphate polyprenol, alpha-3-L-rhamnosyltransferase which attaches a rhamnosyl residues to GlcNAc-P-P-decaprenyl to form Rha-GlcNAc-P-P-decaprenyl; enzymatic evidence
Term	GO:0016758 transferase activity, transferring hexosyl groups - NR	mmcneil	NR		dTDP-Rha:alpha-D-GlcNAc-pyrophosphate polyprenol, alpha-3-L-rhamnosyltransferase which attaches a rhamnosyl residues to GlcNAc-P-P-decaprenyl to form Rha-GlcNAc-P-P-decaprenyl; enzymatic evidence authors,AE. Grzegorzewicz,Y. Ma,V. Jones,D. Crick,A. Liav,MR. McNeil Development of a microtitre plate-based assay for lipid-linked glycosyltransferase products using the mycobacterial cell wall rhamnosyltransferase WbbL. Microbiology (Reading, Engl.) 2008
Citation	Biosynthesis of the galactan component of the mycobacterial cell wall. K. Mikusov, T. Yagi et al. J. Biol. Chem. 2000	extern:JZUCKER		10934214	Assay of unpurified protein expressed in its native host
Term	EC:2.4.1.- Transferases. Glycosyltransferases. Hexosyltransferases. - NR	extern:JZUCKER	NR		Assay of unpurified protein expressed in its native host K. Mikusov, T. Yagi et al. Biosynthesis of the galactan component of the mycobacterial cell wall. J. Biol. Chem. 2000
Citation	Inactivation of the mycobacterial rhamnosyltransferase, which is needed for the formation of the arabinogalactan-peptidoglycan linker, leads to irreversible loss of viability. JA. Mills, K. Motichka et al. J. Biol. Chem. 2004	extern:JZUCKER		15294902	Inferred from mutant phenotype
Term	EC:2.4.1.- Transferases. Glycosyltransferases. Hexosyltransferases. - NR	extern:JZUCKER	NR		Inferred from mutant phenotype JA. Mills, K. Motichka et al. Inactivation of the mycobacterial rhamnosyltransferase, which is needed for the formation of the arabinogalactan-peptidoglycan linker, leads to irreversible loss of viability. J. Biol. Chem. 2004

TB Genome Annotation Portal