TB Genome Annotation Portal

Rv3262 (fbiB)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: gamma-glutamyl ligase
  • REFSEQ: F420-0--gamma-glutamyl ligase
  • PATRIC: Coenzyme F420-0:L-glutamate ligase @ Coenzyme F420-1:L-glutamate ligase / domain of unknown function
  • TUBERCULIST: Probable F420 biosynthesis protein FbiB
  • NCBI: Probable F420 biosynthesis protein FbiB
  • updated information (H37Rv4):
    • gene name: fbiB
    • function:
    • reference:
• Type: Not Target
• Start: 3641535
• End: 3642881
• Operon:


• Trans-membrane region:
  
• Role: V - Conserved hypotheticals
• GO terms:
  • GO:0055114 - oxidation-reduction process (Uniprot)
  • GO:0052619 - coenzyme F420-1:gamma-L-glutamate ligase activity (Uniprot)
  • GO:0052618 - coenzyme F420-0:L-glutamate ligase activity (Uniprot)
  • GO:0051188 - cofactor biosynthetic process (Uniprot)
  • GO:0046872 - metal ion binding (Uniprot)
  • GO:0043773 - coenzyme F420-0 gamma-glutamyl ligase activity (Uniprot)
  • GO:0016881 - acid-amino acid ligase activity (Uniprot)
  • GO:0016874 - ligase activity (Uniprot)
  • GO:0016491 - oxidoreductase activity (Uniprot)
  • GO:0009108 - coenzyme biosynthetic process (Uniprot)
  • GO:0005886 - plasma membrane (Uniprot)
  • GO:0005525 - GTP binding (Uniprot)
  • GO:0000166 - nucleotide binding (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
  • LPPG[c] + FO[c] -> GMP[c] + F420[0][c]
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure:
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020):
  

  PDB	aa ident	species	PDB title
  4XOQ	100%	Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)	F420 complex of coenzyme F420:L-glutamate ligase (FbiB) from Mycobacterium tuberculosis (C-terminal domain)
  4XOO	100%	Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)	FMN complex of coenzyme F420:L-glutamate ligase (FbiB) from Mycobacterium tuberculosis (C-terminal domain)
  4XOM	100%	Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)	Coenzyme F420:L-glutamate ligase (FbiB) from Mycobacterium tuberculosis (C-terminal domain).
  2PHN	39%	Archaeoglobus fulgidus DSM 4304	Crystal structure of an amide bond forming F420-gamma glutamyl ligase from Archaeoglobus fulgidus
  2G9I	39%	Archaeoglobus fulgidus	Crystal structure of homolog of F420-0:gamma-Glutamyl Ligase from Archaeoglobus fulgidus Reveals a Novel Fold.

• Links to additional information on fbiB:
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = 0.352 (from Jeremy Rock's lab)
  • KEGG - nucleotide and amino acid sequences of gene
  • Mycobrowser
  • PATRIC
  • BioCyc
  • Systems Biology

Amino Acid Sequence

LTGPEHGSASTIEILPVIGLPEFRPGDDLSAAVAAAAPWLRDGDVVVVTSKVVSKCEGRLVPAPEDPEQRDRLRRKLIEDEAVRVLARKDRTLITENRLG
LVQAAAGVDGSNVGRSELALLPVDPDASAATLRAGLRERLGVTVAVVITDTMGRAWRNGQTDAAVGAAGLAVLRNYAGVRDPYGNELVVTEVAVADEIAA
AADLVKGKLTATPVAVVRGFGVSDDGSTARQLLRPGANDLFWLGTAEALELGRQQAQLLRRSVRRFSTDPVPGDLVEAAVAEALTAPAPHHTRPTRFVWL
QTPAIRARLLDRMKDKWRSDLTSDGLPADAIERRVARGQILYDAPEVVIPMLVPDGAHSYPDAARTDAEHTMFTVAVGAAVQALLVALAVRGLGSCWIGS
TIFAADLVRDELDLPVDWEPLGAIAIGYADEPSGLRDPVPAADLLILK

Additional Information