TB Genome Annotation Portal

Rv3245c (mtrB)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: sensor histidine kinase mtrB
  • REFSEQ: two component sensory transduction histidine kinase MTRB
  • PATRIC: Sensor histidine kinase MtrB (EC 2.7.3.-)
  • TUBERCULIST: Two component sensory transduction histidine kinase MtrB
  • NCBI: Two component sensory transduction histidine kinase MtrB
  • updated information (H37Rv4):
    • gene name: mtrB
    • function:
    • reference:
• Type: Not Target
• Start: 3624910
• End: 3626613
• Operon:


• Trans-membrane region:
  
• Role: I.J.2 - Two component systems
• GO terms:
  • GO:0040007 - growth (Uniprot)
  • GO:0023014 - signal transduction by protein phosphorylation (Uniprot)
  • GO:0018106 - peptidyl-histidine phosphorylation (Uniprot)
  • GO:0016772 - transferase activity, transferring phosphorus-containing groups (Uniprot)
  • GO:0016740 - transferase activity (Uniprot)
  • GO:0016310 - phosphorylation (Uniprot)
  • GO:0016301 - kinase activity (Uniprot)
  • GO:0016021 - integral component of membrane (Uniprot)
  • GO:0016020 - membrane (Uniprot)
  • GO:0007165 - signal transduction (Uniprot)
  • GO:0005886 - plasma membrane (Uniprot)
  • GO:0005829 - cytosol (Uniprot)
  • GO:0005524 - ATP binding (Uniprot)
  • GO:0004871 - signal transducer activity (Uniprot)
  • GO:0004673 - protein histidine kinase activity (Uniprot)
  • GO:0000166 - nucleotide binding (Uniprot)
  • GO:0000160 - phosphorelay signal transduction system (Uniprot)
  • GO:0000155 - phosphorelay sensor kinase activity (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure:
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020): (none with >35% aa id)
• Links to additional information on mtrB:
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = -2.863 (from Jeremy Rock's lab)
  • KEGG - nucleotide and amino acid sequences of gene
  • Mycobrowser
  • PATRIC
  • BioCyc
  • Systems Biology

Amino Acid Sequence

MIFGSRRRIRGRRGRSGPMTRGLSALSRAVAVAWRRSLQLRVVALTLGLSLAVILALGFVLTSQVTNRVLDIKVRAAIDQIERARTTVSGIVNGEETRSL
DSSLQLARNTLTSKTDPASGAGLAGAFDAVLMVPGDGPRAASTAGPVDQVPNALRGFVKAGQAAYQYATVQTEGFSGPALIIGTPTLSRVANLELYLIFP
LASEQATITLVRGTMATGGLVLLVLLAGIALLVSRQVVVPVRSASRIAERFAEGHLSERMPVRGEDDMARLAVSFNDMAESLSRQIAQLEEFGNLQRRFT
SDVSHELRTPLTTVRMAADLIYDHSADLDPTLRRSTELMVSELDRFETLLNDLLEISRHDAGVAELSVEAVDLRTTVNNALGNVGHLAEEAGIELLVDLP
AEQVIAEVDARRVERILRNLIANAIDHAEHKPVRIRMAADEDTVAVTVRDYGVGLRPGEEKLVFSRFWRSDPSRVRRSGGTGLGLAISVEDARLHQGRLE
AWGEPGEGACFRLTLPMVRGHKVTTSPLPMKPIPQPVLQPVAQPNPQPMPPEYKERQRPREHAEWSG

Additional Information