TB Genome Annotation Portal

Rv3220c (-)

Amino Acid Sequence

MSTLGDLLAEHTVLPGSAVDHLHAVVGEWQLLADLSFADYLMWVRRDDGVLVCVAQCRPNTGPTVVHTDAVGTVVAANSMPLVAATFSGGVPGREGAVGQ
QNSCQHDGHSVEVSPVRFGDQVVAVLTRHQPELAARRRSGHLETAYRLCATDLLRMLAEGTFPDAGDVAMSRSSPRAGDGFIRLDVDGVVSYASPNALSA
YHRMGLTTELEGVNLIDATRPLISDPFEAHEVDEHVQDLLAGDGKGMRMEVDAGGATVLLRTLPLVVAGRNVGAAILIRDVTEVKRRDRALISKDATIRE
IHHRVKNNLQTVAALLRLQARRTSNAEGREALIESVRRVSSIALVHDALSMSVDEQVNLDEVIDRILPIMNDVASVDRPIRINRVGDLGVLDSDRATALI
MVITELVQNAIEHAFDPAAAEGSVTIRAERSARWLDVVVHDDGLGLPQGFSLEKSDSLGLQIVRTLVSAELDGSLGMRDARERGTDVVLRVPVGRRGRLM
L
(Nucleotide sequence available on KEGG)

Additional Information

PdtaS

PdtaSR: 2-component sensor, controls NO and Cu stress response
  Rv3220c/PdtaS - sensor kinase
  Rv1626/PdtaR - RNA binding response regulator; cytosolic, constitutive

Morth (2005) PMID: 16026786
  interacts with Rip1, and an sRNA (PPE1-5')
  Rip1 controls expression of PPE1-5', which binds PdtaR

Buglino, J. A., Sankhe, G. D., Lazar, N., Bean, J. M. & Glickman, M. S. Integrated sensing
of host stresses by inhibition of a cytoplasmic two-component system controls M. tuberculosis
acute lung infection. Elife 10, e65351 (2021). PMID: 34003742


Analysis of Positive Selection in Clinical Isolates *new*

Moldova (2,057)global set (5,195)
under significant positive selection?NONO
omega peak height (95%CI lower bound)2.36 (0.62)1.51 (0.58)
codons under selection
omega plots
genetic variants*linklink
statistics at each codonlinklink
* example format for variants: "D27 (GAC): D27H (CAC,11)" means "Asp27 (native codon GAC) mutated to His (codon CAC) in 11 isolates"


ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across ~100 conditions

Rv3220c/-, gene len: 1505 bp, num TA sites: 22
conditiondatasetcallmediummethodnotes
in-vitroDeJesus 2017 mBionon-essential7H9HMMfully saturated, 14 TnSeq libraries combined
in-vitroSassetti 2003 Mol Microno data 7H9TRASHessential if hybridization ratio<0.2
in-vivo (mice)Sassetti 2003 PNASno data BL6 miceTRASHessential if hybridization ratio<0.4, min over 4 timepoints (1-8 weeks)
in-vitro (glycerol)Griffin 2011 PPathnon-essentialM9 minimal+glycerolGumbel2 replicates; Padj<0.05
in-vitro (cholesterol)Griffin 2011 PPathuncertainM9 minimal+cholesterolGumbel3 replicates; Padj<0.05
differentially essential in cholesterol Griffin 2011 PPathNO (LFC=-0.96)cholesterol vs glycerolresampling-SRYES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in cholesterol
in-vitroSmith 2022 eLifenon-essential7H9HMM6 replicates (raw data in Subramaniam 2017, PMID 31752678)
in-vivo (mice)Smith 2022 eLifenon-essentialBL6 miceHMM6 replicates (raw data in Subramaniam 2017, PMID 31752678)
differentially essential in miceSmith 2022 eLifeNO (LFC=-0.174)in-vivo vs in-vitroZINBYES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in mice
in-vitro (minimal)Minato 2019 mSysnon-essentialminimal mediumHMM
in-vitro (YM rich medium)Minato 2019 mSysgrowth advantageYM rich mediumHMM7H9 supplemented with ~20 metabolites (amino acids, vitamins)
differentially essential in YM rich mediumMinato 2019 mSysYES (LFC=2.49)YM rich vs minimal mediumresampling

TnSeq Data No data currently available.
  • No TnSeq data currently available for this Target.
RNASeq Data No data currently available.
  • No RNA-Seq data currently available for this Target.
Metabolomic Profiles No data currently available.
  • No Metabolomic data currently available for this Target.
Proteomic Data No data currently available.
  • No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology
  • BioCyc

    Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

    NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

    Interactions based on ChIPSeq data

    • Binds To:

      • No bindings to other targets were found.
    • Bound By:

    Interactions based on ChIPSeq data (Minch et al. 2014)

    • Binds To:

      • No bindings to other targets were found.
    • Bound By:

      • No bindings to other targets were found.

    Interactions based on TFOE data (Rustad et al. 2014)

    • Upregulates:

      • Does not upregulate other genes.
    • Upregulated by:

      • Not upregulated by other genes.
    • Downregulates:

      • Does not downregulate other genes.
    • Downregulated by:



    TBCAP

    Tubculosis Community Annotation Project (
    Slayden et al., 2013)

    Rv3220c (-)

    PropertyValueCreatorEvidencePMIDComment
    InteractionRegulatory Rv3220cakankshajain.21IDAStructural Analysis
    JP. Morth, S. Gosmann et al. A novel two-component system found in Mycobacterium tuberculosis. FEBS Lett. 2005
    CitationA novel two-component system found in Mycobacterium tuberculosis. JP. Morth, S. Gosmann et al. FEBS Lett. 2005akankshajain.21IDA16026786Spectrophotometric
    InteractionRegulatory Rv1626akankshajain.21IDASpectrophotometric
    JP. Morth, S. Gosmann et al. A novel two-component system found in Mycobacterium tuberculosis. FEBS Lett. 2005
    InteractionRegulatory Rv3220cakankshajain.21IDASpectrophotometric
    JP. Morth, S. Gosmann et al. A novel two-component system found in Mycobacterium tuberculosis. FEBS Lett. 2005
    InteractionRegulatory Rv3220cakankshajain.21IDASpectrophotometric
    JP. Morth, S. Gosmann et al. A novel two-component system found in Mycobacterium tuberculosis. FEBS Lett. 2005
    CitationA novel two-component system found in Mycobacterium tuberculosis. JP. Morth, S. Gosmann et al. FEBS Lett. 2005akankshajain.21IDA16026786Structural Analysis
    InteractionRegulatory Rv1626akankshajain.21IDAStructural Analysis
    JP. Morth, S. Gosmann et al. A novel two-component system found in Mycobacterium tuberculosis. FEBS Lett. 2005
    InteractionRegulatory Rv3220cakankshajain.21IDAStructural Analysis
    JP. Morth, S. Gosmann et al. A novel two-component system found in Mycobacterium tuberculosis. FEBS Lett. 2005

    Comments