TB Genome Annotation Portal

Rv3213c (-)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: chromosome partitioning protein
  • REFSEQ: SOJ/PARA-like protein
  • PATRIC: Chromosome (plasmid) partitioning protein ParA / Sporulation initiation inhibitor protein Soj
  • TUBERCULIST: Possible SOJ/para-related protein
  • NCBI: Possible SOJ/para-related protein
  • updated information (H37Rv4):
    • gene name: -
    • function:
    • reference:
• Type: Not Target
• Start: 3590692
• End: 3591492
• Operon:


• Trans-membrane region:
  
• Role: III.C - Cell division
• GO terms:
  • GO:0043590 - bacterial nucleoid (Uniprot)
  • GO:0005618 - cell wall (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure:
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020):
  

  PDB	aa ident	species	PDB title
  5IHP	85%	Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155)	Crystal Structure of Cobyrinic Acid a,c-diamide synthase from Mycobacterium smegmatis with bound ADP and Magnesium
  5IF9	85%	Mycobacterium smegmatis	Crystal Structure of Cobyrinic Acid a,c-diamide synthase from Mycobacterium smegmatis with bound ATP analog and Magnesium
  4PFS	85%	Mycobacterium smegmatis	Crystal Structure of Cobyrinic Acid a,c-diamide synthase from Mycobacterium smegmatis
  2BEJ	43%	THERMUS THERMOPHILUS	Structure of the bacterial chromosome segregation protein Soj
  1WCV	43%	THERMUS THERMOPHILUS	Structure of the bacterial chromosome segregation protein Soj
  2BEK	43%	THERMUS THERMOPHILUS	Structure of the bacterial chromosome segregation protein Soj
  6IUD	36%	Helicobacter pylori (strain ATCC 700392 / 26695)	Structure of Helicobacter pylori Soj-ADP complex bound to DNA
  6IUC	36%	Helicobacter pylori (strain ATCC 700392 / 26695)	Structure of Helicobacter pylori Soj-ATP complex bound to DNA
  6IUB	36%	Helicobacter pylori (strain ATCC 700392 / 26695)	Structure of Helicobacter pylori Soj protein

• Links to additional information on Rv3213c:
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = 0.331 (from Jeremy Rock's lab)
  • KEGG - nucleotide and amino acid sequences of gene
  • Mycobrowser
  • PATRIC
  • BioCyc
  • Systems Biology

Amino Acid Sequence

MTDTRVLAVANQKGGVAKTTTVASLGAAMVEKGRRVLLVDLDPQGCLTFSLGQDPDKLPVSVHEVLLGEVEPNAVLVTTMEGMTLLPANIDLAGAEAMLL
MRAGREYALKRALAKFSDRFDVVIIDCPPSLGVLTLNGLTAADKAIVPLQCEMLAHRGVGQFLRTVADVQQITNPNLRLLGALPTLYDSRTTHTRDVLLD
VADRYDLQVLAPPIPRTVRFAEASASGSSVMAGRKNKGAVAYRELAQALLKHWKTGRPLPTFTVDL

Additional Information