TB Genome Annotation Portal

Rv3147 (nuoC)

Amino Acid Sequence

MSPPNQDAQEGRPDSPTAEVVDVRRGMFGVSGTGDTSGYGRLVRQVVLPGSSPRPYGGYFDDIVDRLAEALRHERVEFEDAVEKVVVYRDELTLHVRRDL
LPRVAQRLRDEPELRFELCLGVSGVHYPHETGRELHAVYPLQSITHNRRLRLEVSAPDSDPHIPSLFAIYPTNDWHERETYDFFGIIFDGHPALTRIEMP
DDWQGHPQRKDYPLGGIPVEYKGAQIPPPDERRGYN
(Nucleotide sequence available on KEGG)

Additional Information



ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across ~100 conditions

Rv3147/nuoC, gene len: 710 bp, num TA sites: 14
conditiondatasetcallmediummethodnotes
in-vitroDeJesus 2017 mBionon-essential7H9HMMfully saturated, 14 TnSeq libraries combined
in-vitroSassetti 2003 Mol Microno data 7H9TRASHessential if hybridization ratio<0.2
in-vivo (mice)Sassetti 2003 PNASnon-essential BL6 miceTRASHessential if hybridization ratio<0.4, min over 4 timepoints (1-8 weeks)
in-vitro (glycerol)Griffin 2011 PPathnon-essentialM9 minimal+glycerolGumbel2 replicates; Padj<0.05
in-vitro (cholesterol)Griffin 2011 PPathnon-essentialM9 minimal+cholesterolGumbel3 replicates; Padj<0.05
differentially essential in cholesterol Griffin 2011 PPathNO (LFC=-0.5)cholesterol vs glycerolresampling-SRYES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in cholesterol
in-vitroSmith 2022 eLifenon-essential7H9HMM6 replicates (raw data in Subramaniam 2017, PMID 31752678)
in-vivo (mice)Smith 2022 eLifenon-essentialBL6 miceHMM6 replicates (raw data in Subramaniam 2017, PMID 31752678)
differentially essential in miceSmith 2022 eLifeNO (LFC=0.616)in-vivo vs in-vitroZINBYES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in mice
in-vitro (minimal)Minato 2019 mSysnon-essentialminimal mediumHMM
in-vitro (YM rich medium)Minato 2019 mSysnon-essentialYM rich mediumHMM7H9 supplemented with ~20 metabolites (amino acids, cofactors)
differentially essential in YM rich mediumMinato 2019 mSysNO (LFC=2.28)YM rich vs minimal mediumresampling

Analysis of Positive Selection in Clinical Isolates *new*

Moldova (2,057)global set (5,195)
under significant positive selection?NONO
omega peak height (95%CI lower bound)1.58 (0.13)1.44 (0.51)
codons under selection
omega plotsomega plot across ORF for Moldova isolatesomega plot across ORF for CRyPTIC isolates
genetic variants*linklink
statistics at each codonlinklink
* example format for variants: "D27 (GAC): D27H (CAC,11)" means "Asp27 (native codon GAC) mutated to His (codon CAC) in 11 isolates"



TnSeq Data No data currently available.
  • No TnSeq data currently available for this Target.
RNASeq Data No data currently available.
  • No RNA-Seq data currently available for this Target.
Metabolomic Profiles No data currently available.
  • No Metabolomic data currently available for this Target.
Proteomic Data No data currently available.
  • No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology
  • BioCyc

    Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

    NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

    Interactions based on ChIPSeq data

  • Interactions based on ChIPSeq data (Minch et al. 2014)

    • Binds To:

      • No bindings to other targets were found.
    • Bound By:

    Interactions based on TFOE data (Rustad et al. 2014)

    • Upregulates:

      • Does not upregulate other genes.
    • Upregulated by:

      • Not upregulated by other genes.
    • Downregulates:

      • Does not downregulate other genes.
    • Downregulated by:



    TBCAP

    Tubculosis Community Annotation Project (
    Slayden et al., 2013)

    Rv3147 (nuoC)

    PropertyValueCreatorEvidencePMIDComment
    InteractionPhysicalInteraction Rv3158jhum4u2006ISO
    authors,T. Friedrich,B. Bttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
    InteractionPhysicalInteraction Rv3158jhum4u2006ISO
    authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
    InteractionPhysicalInteraction Rv3158jhum4u2006ISO
    authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
    InteractionPhysicalInteraction Rv3158jhum4u2006ISO
    authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
    InteractionPhysicalInteraction Rv3158jhum4u2006ISO
    authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
    InteractionPhysicalInteraction Rv3158hibeeluckISO
    authors,T. Friedrich,B. Bttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
    InteractionPhysicalInteraction Rv3158hibeeluckISO
    authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
    InteractionPhysicalInteraction Rv3158hibeeluckISO
    authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
    InteractionPhysicalInteraction Rv3158hibeeluckISO
    authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
    InteractionPhysicalInteraction Rv3158hibeeluckISO
    authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
    InteractionPhysicalInteraction Rv3157jhum4u2006ISO
    authors,T. Friedrich,B. Bttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
    InteractionPhysicalInteraction Rv3157jhum4u2006ISO
    authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
    InteractionPhysicalInteraction Rv3157jhum4u2006ISO
    authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
    InteractionPhysicalInteraction Rv3157jhum4u2006ISO
    authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
    InteractionPhysicalInteraction Rv3157jhum4u2006ISO
    authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
    InteractionPhysicalInteraction Rv3157hibeeluckISO
    authors,T. Friedrich,B. Bttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
    InteractionPhysicalInteraction Rv3157hibeeluckISO
    authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
    InteractionPhysicalInteraction Rv3157hibeeluckISO
    authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
    InteractionPhysicalInteraction Rv3157hibeeluckISO
    authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
    InteractionPhysicalInteraction Rv3157hibeeluckISO
    authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
    InteractionPhysicalInteraction Rv3156jhum4u2006ISO
    authors,T. Friedrich,B. Bttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
    InteractionPhysicalInteraction Rv3156jhum4u2006ISO
    authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
    InteractionPhysicalInteraction Rv3156jhum4u2006ISO
    authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
    InteractionPhysicalInteraction Rv3156jhum4u2006ISO
    authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
    InteractionPhysicalInteraction Rv3156jhum4u2006ISO
    authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
    InteractionPhysicalInteraction Rv3156hibeeluckISO
    authors,T. Friedrich,B. Bttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
    InteractionPhysicalInteraction Rv3156hibeeluckISO
    authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
    InteractionPhysicalInteraction Rv3156hibeeluckISO
    authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
    InteractionPhysicalInteraction Rv3156hibeeluckISO
    authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
    InteractionPhysicalInteraction Rv3156hibeeluckISO
    authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
    InteractionPhysicalInteraction Rv3155jhum4u2006ISO
    authors,T. Friedrich,B. Bttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
    InteractionPhysicalInteraction Rv3155jhum4u2006ISO
    authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
    InteractionPhysicalInteraction Rv3155jhum4u2006ISO
    authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
    InteractionPhysicalInteraction Rv3155jhum4u2006ISO
    authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
    InteractionPhysicalInteraction Rv3155jhum4u2006ISO
    authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
    InteractionPhysicalInteraction Rv3155hibeeluckISO
    authors,T. Friedrich,B. Bttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
    InteractionPhysicalInteraction Rv3155hibeeluckISO
    authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
    InteractionPhysicalInteraction Rv3155hibeeluckISO
    authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
    InteractionPhysicalInteraction Rv3155hibeeluckISO
    authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
    InteractionPhysicalInteraction Rv3155hibeeluckISO
    authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
    InteractionPhysicalInteraction Rv3154jhum4u2006ISO
    authors,T. Friedrich,B. Bttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
    InteractionPhysicalInteraction Rv3154jhum4u2006ISO
    authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
    InteractionPhysicalInteraction Rv3154jhum4u2006ISO
    authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
    InteractionPhysicalInteraction Rv3154jhum4u2006ISO
    authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
    InteractionPhysicalInteraction Rv3154jhum4u2006ISO
    authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
    InteractionPhysicalInteraction Rv3154hibeeluckISO
    authors,T. Friedrich,B. Bttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
    InteractionPhysicalInteraction Rv3154hibeeluckISO
    authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
    InteractionPhysicalInteraction Rv3154hibeeluckISO
    authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
    InteractionPhysicalInteraction Rv3154hibeeluckISO
    authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
    InteractionPhysicalInteraction Rv3154hibeeluckISO
    authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
    InteractionPhysicalInteraction Rv3153jhum4u2006ISO
    authors,T. Friedrich,B. Bttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
    InteractionPhysicalInteraction Rv3153jhum4u2006ISO
    authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
    InteractionPhysicalInteraction Rv3153jhum4u2006ISO
    authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
    InteractionPhysicalInteraction Rv3153jhum4u2006ISO
    authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
    InteractionPhysicalInteraction Rv3153jhum4u2006ISO
    authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
    InteractionPhysicalInteraction Rv3153hibeeluckISO
    authors,T. Friedrich,B. Bttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
    InteractionPhysicalInteraction Rv3153hibeeluckISO
    authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
    InteractionPhysicalInteraction Rv3153hibeeluckISO
    authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
    InteractionPhysicalInteraction Rv3153hibeeluckISO
    authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
    InteractionPhysicalInteraction Rv3153hibeeluckISO
    authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
    InteractionPhysicalInteraction Rv3152jhum4u2006ISO
    authors,T. Friedrich,B. Bttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
    InteractionPhysicalInteraction Rv3152jhum4u2006ISO
    authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
    InteractionPhysicalInteraction Rv3152jhum4u2006ISO
    authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
    InteractionPhysicalInteraction Rv3152jhum4u2006ISO
    authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
    InteractionPhysicalInteraction Rv3152jhum4u2006ISO
    authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
    InteractionPhysicalInteraction Rv3152hibeeluckISO
    authors,T. Friedrich,B. Bttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
    InteractionPhysicalInteraction Rv3152hibeeluckISO
    authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
    InteractionPhysicalInteraction Rv3152hibeeluckISO
    authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
    InteractionPhysicalInteraction Rv3152hibeeluckISO
    authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
    InteractionPhysicalInteraction Rv3152hibeeluckISO
    authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
    InteractionPhysicalInteraction Rv3151jhum4u2006ISO
    authors,T. Friedrich,B. Bttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
    InteractionPhysicalInteraction Rv3151jhum4u2006ISO
    authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
    InteractionPhysicalInteraction Rv3151jhum4u2006ISO
    authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
    InteractionPhysicalInteraction Rv3151jhum4u2006ISO
    authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
    InteractionPhysicalInteraction Rv3151jhum4u2006ISO
    authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
    InteractionPhysicalInteraction Rv3151hibeeluckISO
    authors,T. Friedrich,B. Bttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
    InteractionPhysicalInteraction Rv3151hibeeluckISO
    authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
    InteractionPhysicalInteraction Rv3151hibeeluckISO
    authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
    InteractionPhysicalInteraction Rv3151hibeeluckISO
    authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
    InteractionPhysicalInteraction Rv3151hibeeluckISO
    authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
    InteractionPhysicalInteraction Rv3150jhum4u2006ISO
    authors,T. Friedrich,B. Bttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
    InteractionPhysicalInteraction Rv3150jhum4u2006ISO
    authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
    InteractionPhysicalInteraction Rv3150jhum4u2006ISO
    authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
    InteractionPhysicalInteraction Rv3150jhum4u2006ISO
    authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
    InteractionPhysicalInteraction Rv3150jhum4u2006ISO
    authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
    InteractionPhysicalInteraction Rv3150hibeeluckISO
    authors,T. Friedrich,B. Bttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
    InteractionPhysicalInteraction Rv3150hibeeluckISO
    authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
    InteractionPhysicalInteraction Rv3150hibeeluckISO
    authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
    InteractionPhysicalInteraction Rv3150hibeeluckISO
    authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
    InteractionPhysicalInteraction Rv3150hibeeluckISO
    authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
    InteractionPhysicalInteraction Rv3149jhum4u2006ISO
    authors,T. Friedrich,B. Bttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
    InteractionPhysicalInteraction Rv3149jhum4u2006ISO
    authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
    InteractionPhysicalInteraction Rv3149jhum4u2006ISO
    authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
    InteractionPhysicalInteraction Rv3149jhum4u2006ISO
    authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
    InteractionPhysicalInteraction Rv3149jhum4u2006ISO
    authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
    InteractionPhysicalInteraction Rv3149hibeeluckISO
    authors,T. Friedrich,B. Bttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
    InteractionPhysicalInteraction Rv3149hibeeluckISO
    authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
    InteractionPhysicalInteraction Rv3149hibeeluckISO
    authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
    InteractionPhysicalInteraction Rv3149hibeeluckISO
    authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
    InteractionPhysicalInteraction Rv3149hibeeluckISO
    authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
    InteractionPhysicalInteraction Rv3148jhum4u2006ISO
    authors,T. Friedrich,B. Bttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
    InteractionPhysicalInteraction Rv3148jhum4u2006ISO
    authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
    InteractionPhysicalInteraction Rv3148jhum4u2006ISO
    authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
    InteractionPhysicalInteraction Rv3148jhum4u2006ISO
    authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
    InteractionPhysicalInteraction Rv3148jhum4u2006ISO
    authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
    InteractionPhysicalInteraction Rv3148hibeeluckISO
    authors,T. Friedrich,B. Bttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
    InteractionPhysicalInteraction Rv3148hibeeluckISO
    authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
    InteractionPhysicalInteraction Rv3148hibeeluckISO
    authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
    InteractionPhysicalInteraction Rv3148hibeeluckISO
    authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
    InteractionPhysicalInteraction Rv3148hibeeluckISO
    authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
    InteractionPhysicalInteraction Rv3153jhum4u2006ISO
    authors,T. Friedrich,B. Bttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
    InteractionPhysicalInteraction Rv3154jhum4u2006ISO
    authors,T. Friedrich,B. Bttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
    InteractionPhysicalInteraction Rv3155jhum4u2006ISO
    authors,T. Friedrich,B. Bttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
    InteractionPhysicalInteraction Rv3156jhum4u2006ISO
    authors,T. Friedrich,B. Bttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
    InteractionPhysicalInteraction Rv3157jhum4u2006ISO
    authors,T. Friedrich,B. Bttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
    InteractionPhysicalInteraction Rv3158jhum4u2006ISO
    authors,T. Friedrich,B. Bttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
    InteractionPhysicalInteraction Rv3158jhum4u2006ISO
    authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
    CitationThe gross structure of the respiratory complex I: a Lego System. authors,T. Friedrich,B. Bttcher Biochim. Biophys. Acta 2004jhum4u2006ISO14741580None
    InteractionPhysicalInteraction Rv3145jhum4u2006ISO
    authors,T. Friedrich,B. Bttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
    InteractionPhysicalInteraction Rv3146jhum4u2006ISO
    authors,T. Friedrich,B. Bttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
    InteractionPhysicalInteraction Rv3148jhum4u2006ISO
    authors,T. Friedrich,B. Bttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
    InteractionPhysicalInteraction Rv3149jhum4u2006ISO
    authors,T. Friedrich,B. Bttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
    InteractionPhysicalInteraction Rv3150jhum4u2006ISO
    authors,T. Friedrich,B. Bttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
    InteractionPhysicalInteraction Rv3151jhum4u2006ISO
    authors,T. Friedrich,B. Bttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
    InteractionPhysicalInteraction Rv3152jhum4u2006ISO
    authors,T. Friedrich,B. Bttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
    InteractionPhysicalInteraction Rv3153jhum4u2006ISO
    authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
    InteractionPhysicalInteraction Rv3154jhum4u2006ISO
    authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
    InteractionPhysicalInteraction Rv3155jhum4u2006ISO
    authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
    InteractionPhysicalInteraction Rv3156jhum4u2006ISO
    authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
    InteractionPhysicalInteraction Rv3157jhum4u2006ISO
    authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
    InteractionPhysicalInteraction Rv3146jhum4u2006ISO
    authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
    InteractionPhysicalInteraction Rv3148jhum4u2006ISO
    authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
    InteractionPhysicalInteraction Rv3149jhum4u2006ISO
    authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
    InteractionPhysicalInteraction Rv3150jhum4u2006ISO
    authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
    InteractionPhysicalInteraction Rv3151jhum4u2006ISO
    authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
    InteractionPhysicalInteraction Rv3152jhum4u2006ISO
    authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
    InteractionPhysicalInteraction Rv3153jhum4u2006ISO
    authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
    InteractionPhysicalInteraction Rv3154jhum4u2006ISO
    authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
    InteractionPhysicalInteraction Rv3155jhum4u2006ISO
    authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
    InteractionPhysicalInteraction Rv3156jhum4u2006ISO
    authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
    InteractionPhysicalInteraction Rv3157jhum4u2006ISO
    authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
    InteractionPhysicalInteraction Rv3158jhum4u2006ISO
    authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
    CitationComparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Microbiology (Reading, Engl.) 2007jhum4u2006ISO17906132None
    InteractionPhysicalInteraction Rv3145jhum4u2006ISO
    authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
    InteractionPhysicalInteraction Rv3158jhum4u2006ISO
    authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
    CitationSurvival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. authors,LS. Meena,null. Rajni FEBS J. 2010jhum4u2006ISO20553485None
    InteractionPhysicalInteraction Rv3145jhum4u2006ISO
    authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
    InteractionPhysicalInteraction Rv3146jhum4u2006ISO
    authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
    InteractionPhysicalInteraction Rv3148jhum4u2006ISO
    authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
    InteractionPhysicalInteraction Rv3149jhum4u2006ISO
    authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
    InteractionPhysicalInteraction Rv3150jhum4u2006ISO
    authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
    InteractionPhysicalInteraction Rv3151jhum4u2006ISO
    authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
    InteractionPhysicalInteraction Rv3152jhum4u2006ISO
    authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
    InteractionPhysicalInteraction Rv3151jhum4u2006ISO
    authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
    InteractionPhysicalInteraction Rv3152jhum4u2006ISO
    authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
    InteractionPhysicalInteraction Rv3153jhum4u2006ISO
    authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
    InteractionPhysicalInteraction Rv3154jhum4u2006ISO
    authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
    InteractionPhysicalInteraction Rv3155jhum4u2006ISO
    authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
    InteractionPhysicalInteraction Rv3156jhum4u2006ISO
    authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
    InteractionPhysicalInteraction Rv3157jhum4u2006ISO
    authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
    InteractionPhysicalInteraction Rv3158jhum4u2006ISO
    authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
    CitationThe gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. authors,LM. Fu,CS. Fu-Liu BMC Microbiol. 2007jhum4u2006ISO17501996None
    InteractionPhysicalInteraction Rv3145jhum4u2006ISO
    authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
    InteractionPhysicalInteraction Rv3146jhum4u2006ISO
    authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
    InteractionPhysicalInteraction Rv3148jhum4u2006ISO
    authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
    InteractionPhysicalInteraction Rv3149jhum4u2006ISO
    authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
    InteractionPhysicalInteraction Rv3150jhum4u2006ISO
    authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
    InteractionPhysicalInteraction Rv3151jhum4u2006ISO
    authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
    InteractionPhysicalInteraction Rv3152jhum4u2006ISO
    authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
    InteractionPhysicalInteraction Rv3153jhum4u2006ISO
    authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
    InteractionPhysicalInteraction Rv3154jhum4u2006ISO
    authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
    InteractionPhysicalInteraction Rv3155jhum4u2006ISO
    authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
    InteractionPhysicalInteraction Rv3156jhum4u2006ISO
    authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
    InteractionPhysicalInteraction Rv3157jhum4u2006ISO
    authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
    InteractionPhysicalInteraction Rv3158hibeeluckISO
    authors,T. Friedrich,B. Bttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
    CitationThe NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. authors,GF. Dancey,AE. Levine,BM. Shapiro J. Biol. Chem. 1976jhum4u2006ISO786986None
    InteractionPhysicalInteraction Rv3145jhum4u2006ISO
    authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
    InteractionPhysicalInteraction Rv3146jhum4u2006ISO
    authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
    InteractionPhysicalInteraction Rv3148jhum4u2006ISO
    authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
    InteractionPhysicalInteraction Rv3149jhum4u2006ISO
    authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
    InteractionPhysicalInteraction Rv3150jhum4u2006ISO
    authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
    InteractionPhysicalInteraction Rv3150hibeeluckISO
    authors,T. Friedrich,B. Bttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
    InteractionPhysicalInteraction Rv3151hibeeluckISO
    authors,T. Friedrich,B. Bttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
    InteractionPhysicalInteraction Rv3152hibeeluckISO
    authors,T. Friedrich,B. Bttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
    InteractionPhysicalInteraction Rv3153hibeeluckISO
    authors,T. Friedrich,B. Bttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
    InteractionPhysicalInteraction Rv3154hibeeluckISO
    authors,T. Friedrich,B. Bttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
    InteractionPhysicalInteraction Rv3155hibeeluckISO
    authors,T. Friedrich,B. Bttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
    InteractionPhysicalInteraction Rv3156hibeeluckISO
    authors,T. Friedrich,B. Bttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
    InteractionPhysicalInteraction Rv3157hibeeluckISO
    authors,T. Friedrich,B. Bttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
    InteractionPhysicalInteraction Rv3157hibeeluckISO
    authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
    InteractionPhysicalInteraction Rv3158hibeeluckISO
    authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
    CitationThe gross structure of the respiratory complex I: a Lego System. authors,T. Friedrich,B. Bttcher Biochim. Biophys. Acta 2004hibeeluckISO14741580None
    InteractionPhysicalInteraction Rv3145hibeeluckISO
    authors,T. Friedrich,B. Bttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
    InteractionPhysicalInteraction Rv3146hibeeluckISO
    authors,T. Friedrich,B. Bttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
    InteractionPhysicalInteraction Rv3148hibeeluckISO
    authors,T. Friedrich,B. Bttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
    InteractionPhysicalInteraction Rv3149hibeeluckISO
    authors,T. Friedrich,B. Bttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
    InteractionPhysicalInteraction Rv3151hibeeluckISO
    authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
    InteractionPhysicalInteraction Rv3152hibeeluckISO
    authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
    InteractionPhysicalInteraction Rv3153hibeeluckISO
    authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
    InteractionPhysicalInteraction Rv3154hibeeluckISO
    authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
    InteractionPhysicalInteraction Rv3155hibeeluckISO
    authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
    InteractionPhysicalInteraction Rv3156hibeeluckISO
    authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
    CitationComparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Microbiology (Reading, Engl.) 2007hibeeluckISO17906132None
    InteractionPhysicalInteraction Rv3145hibeeluckISO
    authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
    InteractionPhysicalInteraction Rv3146hibeeluckISO
    authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
    InteractionPhysicalInteraction Rv3148hibeeluckISO
    authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
    InteractionPhysicalInteraction Rv3149hibeeluckISO
    authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
    InteractionPhysicalInteraction Rv3150hibeeluckISO
    authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
    InteractionPhysicalInteraction Rv3151hibeeluckISO
    authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
    InteractionPhysicalInteraction Rv3152hibeeluckISO
    authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
    InteractionPhysicalInteraction Rv3153hibeeluckISO
    authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
    InteractionPhysicalInteraction Rv3154hibeeluckISO
    authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
    InteractionPhysicalInteraction Rv3155hibeeluckISO
    authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
    InteractionPhysicalInteraction Rv3156hibeeluckISO
    authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
    InteractionPhysicalInteraction Rv3157hibeeluckISO
    authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
    InteractionPhysicalInteraction Rv3158hibeeluckISO
    authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
    InteractionPhysicalInteraction Rv3156hibeeluckISO
    authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
    InteractionPhysicalInteraction Rv3157hibeeluckISO
    authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
    InteractionPhysicalInteraction Rv3158hibeeluckISO
    authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
    CitationSurvival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. authors,LS. Meena,null. Rajni FEBS J. 2010hibeeluckISO20553485None
    InteractionPhysicalInteraction Rv3145hibeeluckISO
    authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
    InteractionPhysicalInteraction Rv3146hibeeluckISO
    authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
    InteractionPhysicalInteraction Rv3148hibeeluckISO
    authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
    InteractionPhysicalInteraction Rv3149hibeeluckISO
    authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
    InteractionPhysicalInteraction Rv3150hibeeluckISO
    authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
    InteractionPhysicalInteraction Rv3149hibeeluckISO
    authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
    InteractionPhysicalInteraction Rv3150hibeeluckISO
    authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
    InteractionPhysicalInteraction Rv3151hibeeluckISO
    authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
    InteractionPhysicalInteraction Rv3152hibeeluckISO
    authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
    InteractionPhysicalInteraction Rv3153hibeeluckISO
    authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
    InteractionPhysicalInteraction Rv3154hibeeluckISO
    authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
    InteractionPhysicalInteraction Rv3155hibeeluckISO
    authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
    InteractionPhysicalInteraction Rv3156hibeeluckISO
    authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
    InteractionPhysicalInteraction Rv3157hibeeluckISO
    authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
    InteractionPhysicalInteraction Rv3158hibeeluckISO
    authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
    CitationThe gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. authors,LM. Fu,CS. Fu-Liu BMC Microbiol. 2007hibeeluckISO17501996None
    InteractionPhysicalInteraction Rv3145hibeeluckISO
    authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
    InteractionPhysicalInteraction Rv3146hibeeluckISO
    authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
    InteractionPhysicalInteraction Rv3148hibeeluckISO
    authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
    InteractionPhysicalInteraction Rv3149hibeeluckISO
    authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
    InteractionPhysicalInteraction Rv3150hibeeluckISO
    authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
    InteractionPhysicalInteraction Rv3151hibeeluckISO
    authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
    InteractionPhysicalInteraction Rv3152hibeeluckISO
    authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
    InteractionPhysicalInteraction Rv3153hibeeluckISO
    authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
    InteractionPhysicalInteraction Rv3154hibeeluckISO
    authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
    InteractionPhysicalInteraction Rv3155hibeeluckISO
    authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
    CitationThe NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. authors,GF. Dancey,AE. Levine,BM. Shapiro J. Biol. Chem. 1976hibeeluckISO786986None
    InteractionPhysicalInteraction Rv3145hibeeluckISO
    authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
    InteractionPhysicalInteraction Rv3146hibeeluckISO
    authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
    InteractionPhysicalInteraction Rv3148hibeeluckISO
    authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
    InteractionPhysicalInteraction Rv3146jhum4u2006ISO
    authors,T. Friedrich,B. Bttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
    InteractionPhysicalInteraction Rv3146jhum4u2006ISO
    authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
    InteractionPhysicalInteraction Rv3146jhum4u2006ISO
    authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
    InteractionPhysicalInteraction Rv3146jhum4u2006ISO
    authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
    InteractionPhysicalInteraction Rv3146jhum4u2006ISO
    authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
    InteractionPhysicalInteraction Rv3146hibeeluckISO
    authors,T. Friedrich,B. Bttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
    InteractionPhysicalInteraction Rv3146hibeeluckISO
    authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
    InteractionPhysicalInteraction Rv3146hibeeluckISO
    authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
    InteractionPhysicalInteraction Rv3146hibeeluckISO
    authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
    InteractionPhysicalInteraction Rv3146hibeeluckISO
    authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
    InteractionPhysicalInteraction Rv3145jhum4u2006ISO
    authors,T. Friedrich,B. Bttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
    InteractionPhysicalInteraction Rv3145jhum4u2006ISO
    authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
    InteractionPhysicalInteraction Rv3145jhum4u2006ISO
    authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
    InteractionPhysicalInteraction Rv3145jhum4u2006ISO
    authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
    InteractionPhysicalInteraction Rv3145jhum4u2006ISO
    authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
    InteractionPhysicalInteraction Rv3145hibeeluckISO
    authors,T. Friedrich,B. Bttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
    InteractionPhysicalInteraction Rv3145hibeeluckISO
    authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
    InteractionPhysicalInteraction Rv3145hibeeluckISO
    authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
    InteractionPhysicalInteraction Rv3145hibeeluckISO
    authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
    InteractionPhysicalInteraction Rv3145hibeeluckISO
    authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
    InteractionRegulatory Rv0757singhpankaj2116IEPCo-expression (Functional linkage)
    ML. Chesne-Seck, N. Barilone et al. A point mutation in the two-component regulator PhoP-PhoR accounts for the absence of polyketide-derived acyltrehaloses but not that of phthiocerol dimycocerosates in Mycobacterium tuberculosis H37Ra. J. Bacteriol. 2008
    InteractionRegulatory Rv0757singhpankaj2116IEPCo-expression (Functional linkage)
    authors,A. Sola-Landa,RS. Moura,JF. Martn The two-component PhoR-PhoP system controls both primary metabolism and secondary metabolite biosynthesis in Streptomyces lividans. Proc. Natl. Acad. Sci. U.S.A. 2003
    InteractionRegulatory Rv0757singhpankaj2116IEPCo-expression (Functional linkage)
    J. Gonzalo Asensio, C. Maia et al. The virulence-associated two-component PhoP-PhoR system controls the biosynthesis of polyketide-derived lipids in Mycobacterium tuberculosis. J. Biol. Chem. 2006
    InteractionRegulatory Rv0757singhpankaj2116IEPCo-expression (Functional linkage)
    J. Gonzalo-Asensio, CY. Soto et al. The Mycobacterium tuberculosis phoPR operon is positively autoregulated in the virulent strain H37Rv. J. Bacteriol. 2008
    InteractionRegulatory Rv0757singhpankaj2116IEPCo-expression (Functional linkage)
    A. Sinha, S. Gupta et al. PhoP-PhoP interaction at adjacent PhoP binding sites is influenced by protein phosphorylation. J. Bacteriol. 2008
    InteractionRegulatory Rv0757singhpankaj2116IEPCo-expression (Functional linkage)
    J. Gonzalo Asensio, C. Maia et al. The virulence-associated two-component PhoP-PhoR system controls the biosynthesis of polyketide-derived lipids in Mycobacterium tuberculosis. J. Biol. Chem. 2006
    InteractionRegulatory Rv0757singhpankaj2116IEPCo-expression (Functional linkage)
    M. Ryndak, S. Wang et al. PhoP, a key player in Mycobacterium tuberculosis virulence. Trends Microbiol. 2008
    InteractionRegulatory Rv0757singhpankaj2116IEPCo-expression (Functional linkage)
    JA. Asensio, A. Arbus et al. Live tuberculosis vaccines based on phoP mutants: a step towards clinical trials. Expert opinion on biological therapy 2008
    InteractionRegulatory Rv0757singhpankaj2116IEPCo-expression (Functional linkage)
    SB. Walters, E. Dubnau et al. The Mycobacterium tuberculosis PhoPR two-component system regulates genes essential for virulence and complex lipid biosynthesis. Mol. Microbiol. 2006
    InteractionRegulatory Rv0757singhpankaj2116IEPCo-expression (Functional linkage)
    J. Gonzalo-Asensio, S. Mostowy et al. PhoP: a missing piece in the intricate puzzle of Mycobacterium tuberculosis virulence. PLoS ONE 2008
    InteractionRegulatedBy Rv0757yamir.morenoIEPMicroarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
    J. Gonzalo Asensio, C. Maia et al. The virulence-associated two-component PhoP-PhoR system controls the biosynthesis of polyketide-derived lipids in Mycobacterium tuberculosis. J. Biol. Chem. 2006

    Comments