TB Genome Annotation Portal

Rv3134c (-)

Amino Acid Sequence

MSDPRPARAVVVGIDGSRAATHAALWAVDEAVNRDIPLRLVYVIDPSQLSAAGEGGGQSAARAALHDASRKVEATGQPVKIETEVLCGRPLTKLMQESRS
AAMLCVGSVGLDHVRGRRGSVAATLAGSALCPVAVIHPSPAEPATTSQVSAVVAEVDNGVVLRHAFEEARLRGVPLRAVAVHAAETPDDVEQGSRLAHVH
LSRRLAHWTRLYPEVRVDRAIAGGSACRHLAANAKPGQLFVADSHSAHELCGAYQPGCAVLTVRSANL
(Nucleotide sequence available on KEGG)

Additional Information



ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across ~100 conditions

Rv3134c/-, gene len: 806 bp, num TA sites: 10
conditiondatasetcallmediummethodnotes
in-vitroDeJesus 2017 mBionon-essential7H9HMMfully saturated, 14 TnSeq libraries combined
in-vitroSassetti 2003 Mol Micronon-essential 7H9TRASHessential if hybridization ratio<0.2
in-vivo (mice)Sassetti 2003 PNASnon-essential BL6 miceTRASHessential if hybridization ratio<0.4, min over 4 timepoints (1-8 weeks)
in-vitro (glycerol)Griffin 2011 PPathnon-essentialM9 minimal+glycerolGumbel2 replicates; Padj<0.05
in-vitro (cholesterol)Griffin 2011 PPathnon-essentialM9 minimal+cholesterolGumbel3 replicates; Padj<0.05
differentially essential in cholesterol Griffin 2011 PPathNO (LFC=-0.02)cholesterol vs glycerolresampling-SRYES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in cholesterol
in-vitroSmith 2022 eLifenon-essential7H9HMM6 replicates (raw data in Subramaniam 2017, PMID 31752678)
in-vivo (mice)Smith 2022 eLifenon-essentialBL6 miceHMM6 replicates (raw data in Subramaniam 2017, PMID 31752678)
differentially essential in miceSmith 2022 eLifeNO (LFC=-0.154)in-vivo vs in-vitroZINBYES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in mice
in-vitro (minimal)Minato 2019 mSysnon-essentialminimal mediumHMM
in-vitro (YM rich medium)Minato 2019 mSysnon-essentialYM rich mediumHMM7H9 supplemented with ~20 metabolites (amino acids, cofactors)
differentially essential in YM rich mediumMinato 2019 mSysNO (LFC=-0.02)YM rich vs minimal mediumresampling

Analysis of Positive Selection in Clinical Isolates *new*

global set of 10,626 Mtb clinical isolates
under significant positive selection?NO
omega peak height (95%CI lower bound)1.28 (0.68)
codons under selection
omega plotsomega plot across ORF
genetic variants*link
* example format for variants: "D27 (GAC): D27H (CAC,11)" means "Asp27 (native codon GAC) mutated to His (codon CAC) in 11 isolates"



TnSeq Data No data currently available.
  • No TnSeq data currently available for this Target.
RNASeq Data No data currently available.
  • No RNA-Seq data currently available for this Target.
Metabolomic Profiles No data currently available.
  • No Metabolomic data currently available for this Target.
Proteomic Data No data currently available.
  • No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology
  • BioCyc

    Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

    NOTE: see table of TFOE interactions below

    Interactions based on ChIPSeq data

  • Interactions based on ChIPSeq data (Minch et al. 2014)

    Interactions based on TFOE data (Rustad et al. 2014)

    TFOE = Transcription Factor Over-Expression study
    significance criteria used in paper: greater than 2-fold change (|LFC|>=1.0) and Padj<0.01

    genedysregulated by OE ofLFC
    Rv3134c/-Rv3133c/dosR/devR3.8
    Rv3134c/-Rv1404/-1.67
    Rv3134c/-Rv0081/-1.14
    Rv3134c/-Rv3416/whiB3-1.3


    TBCAP

    Tubculosis Community Annotation Project (
    Slayden et al., 2013)

    Rv3134c (-)

    PropertyValueCreatorEvidencePMIDComment
    InteractionPhysicalInteraction Rv3133ckaveri.vermaIPIAffinity purification (Physical interaction)
    G. Bagchi, null. Mayuri et al. Hypoxia-responsive expression of Mycobacterium tuberculosis Rv3134c and devR promoters in Mycobacterium smegmatis. Microbiology (Reading, Engl.) 2003
    CitationThe role of the dosR/dosS two-component regulatory system in Mycobacterium tuberculosis virulence in three animal models. PJ. Converse, PC. Karakousis et al. Infect. Immun. 2008kaveri.vermaIPI19103767Affinity purification (Physical interaction)
    InteractionPhysicalInteraction Rv3132ckaveri.vermaIPIAffinity purification (Physical interaction)
    PJ. Converse, PC. Karakousis et al. The role of the dosR/dosS two-component regulatory system in Mycobacterium tuberculosis virulence in three animal models. Infect. Immun. 2008
    InteractionPhysicalInteraction Rv3133ckaveri.vermaIPIAffinity purification (Physical interaction)
    PJ. Converse, PC. Karakousis et al. The role of the dosR/dosS two-component regulatory system in Mycobacterium tuberculosis virulence in three animal models. Infect. Immun. 2008
    CitationRv3134c/devR/devS operon of Mycobacterium bovis BCG is differentially transcribed under in vitro stress conditions. JG. Rodriguez, CS. Burbano et al. Tuberculosis (Edinburgh, Scotland) 2008kaveri.vermaIPI18243053Affinity purification (Physical interaction)
    InteractionPhysicalInteraction Rv3132ckaveri.vermaIPIAffinity purification (Physical interaction)
    JG. Rodriguez, CS. Burbano et al. Rv3134c/devR/devS operon of Mycobacterium bovis BCG is differentially transcribed under in vitro stress conditions. Tuberculosis (Edinburgh, Scotland) 2008
    InteractionPhysicalInteraction Rv3133ckaveri.vermaIPIAffinity purification (Physical interaction)
    JG. Rodriguez, CS. Burbano et al. Rv3134c/devR/devS operon of Mycobacterium bovis BCG is differentially transcribed under in vitro stress conditions. Tuberculosis (Edinburgh, Scotland) 2008
    CitationHypoxia-responsive expression of Mycobacterium tuberculosis Rv3134c and devR promoters in Mycobacterium smegmatis. G. Bagchi, null. Mayuri et al. Microbiology (Reading, Engl.) 2003kaveri.vermaIPI12949157Affinity purification (Physical interaction)
    InteractionPhysicalInteraction Rv3132ckaveri.vermaIPIAffinity purification (Physical interaction)
    G. Bagchi, null. Mayuri et al. Hypoxia-responsive expression of Mycobacterium tuberculosis Rv3134c and devR promoters in Mycobacterium smegmatis. Microbiology (Reading, Engl.) 2003
    CitationCooperative binding of phosphorylated DevR to upstream sites is necessary and sufficient for activation of the Rv3134c-devRS operon in Mycobacterium tuberculosis: implication in the induction of DevR target genes. S. Chauhan & JS. Tyagi J. Bacteriol. 2008kaveri.vermaIPI18359816Affinity purification (Physical interaction)
    InteractionPhysicalInteraction Rv3132ckaveri.vermaIPIAffinity purification (Physical interaction)
    S. Chauhan & JS. Tyagi Cooperative binding of phosphorylated DevR to upstream sites is necessary and sufficient for activation of the Rv3134c-devRS operon in Mycobacterium tuberculosis: implication in the induction of DevR target genes. J. Bacteriol. 2008
    InteractionPhysicalInteraction Rv3133ckaveri.vermaIPIAffinity purification (Physical interaction)
    S. Chauhan & JS. Tyagi Cooperative binding of phosphorylated DevR to upstream sites is necessary and sufficient for activation of the Rv3134c-devRS operon in Mycobacterium tuberculosis: implication in the induction of DevR target genes. J. Bacteriol. 2008
    CitationMolecular analysis of the dormancy response in Mycobacterium smegmatis: expression analysis of genes encoding the DevR-DevS two-component system, Rv3134c and chaperone alpha-crystallin homologues. null. Mayuri, G. Bagchi et al. FEMS Microbiol. Lett. 2002kaveri.vermaIPI12076818Affinity purification (Physical interaction)
    InteractionPhysicalInteraction Rv3132ckaveri.vermaIPIAffinity purification (Physical interaction)
    null. Mayuri, G. Bagchi et al. Molecular analysis of the dormancy response in Mycobacterium smegmatis: expression analysis of genes encoding the DevR-DevS two-component system, Rv3134c and chaperone alpha-crystallin homologues. FEMS Microbiol. Lett. 2002
    InteractionPhysicalInteraction Rv3133ckaveri.vermaIPIAffinity purification (Physical interaction)
    null. Mayuri, G. Bagchi et al. Molecular analysis of the dormancy response in Mycobacterium smegmatis: expression analysis of genes encoding the DevR-DevS two-component system, Rv3134c and chaperone alpha-crystallin homologues. FEMS Microbiol. Lett. 2002
    InteractionRegulatedBy Rv3911yamir.morenoIEPMicroarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
    S. Raman, X. Puyang et al. Mycobacterium tuberculosis SigM positively regulates Esx secreted protein and nonribosomal peptide synthetase genes and down regulates virulence-associated surface lipid synthesis. J. Bacteriol. 2006
    InteractionRegulatedBy Rv3833yamir.morenoIDAOne hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. .
    M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
    InteractionRegulatedBy Rv3692yamir.morenoIDAOne hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. .
    M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
    InteractionRegulatedBy Rv3133cyamir.morenoIDAOne hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. .
    M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
    InteractionRegulatedBy Rv2669yamir.morenoIDAOne hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. .
    M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
    InteractionRegulatedBy Rv2017yamir.morenoIDAOne hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. .
    M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
    InteractionRegulatedBy Rv0491yamir.morenoIDAOne hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. .
    M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
    InteractionRegulatedBy Rv3133cyamir.morenoTASLiterature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
    G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008

    Comments