Rv3133c (devR)

Current annotations:
- TBCAP: (community-based annotations - see table at bottom of page)
- TBDB: transcriptional regulatory protein devR (dosR)
- REFSEQ: two component transcriptional regulatory protein DevR
- PATRIC: Two component transcriptional regulatory protein DevR
- TUBERCULIST: Two component transcriptional regulatory protein DevR (probably LuxR/UhpA-family)
- NCBI: Two component transcriptional regulatory protein DevR (probably LuxR/UhpA-family)
- updated information (H37Rv4):
  - gene name: dosR/devR
  - function:
  - reference:
Type: Not Target
Start: 3499262
End: 3499915
Operon:

Trans-membrane region:
Role: I.J.2 - Two component systems
GO terms:
- GO:1902882 - regulation of response to oxidative stress (Uniprot)
- GO:0072493 - host cell endosome lumen (Uniprot)
- GO:0045893 - positive regulation of transcription, DNA-templated (Uniprot)
- GO:0044161 - host cell cytoplasmic vesicle (Uniprot)
- GO:0022611 - dormancy process (Uniprot)
- GO:0019217 - regulation of fatty acid metabolic process (Uniprot)
- GO:0009405 - pathogenesis (Uniprot)
- GO:0006355 - regulation of transcription, DNA-templated (Uniprot)
- GO:0006351 - transcription, DNA-templated (Uniprot)
- GO:0005886 - plasma membrane (Uniprot)
- GO:0005829 - cytosol (Uniprot)
- GO:0005737 - cytoplasm (Uniprot)
- GO:0005618 - cell wall (Uniprot)
- GO:0005615 - extracellular space (Uniprot)
- GO:0003700 - DNA binding transcription factor activity (Uniprot)
- GO:0003677 - DNA binding (Uniprot)
- GO:0001666 - response to hypoxia (Uniprot)
- GO:0000160 - phosphorelay signal transduction system (Uniprot)
Reaction(s) (based on iSM810 metabolic model):
Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
Orthologs among selected mycobacteria
Protein structure: 3c57, 3c3w, 1zlj, 1zlk
Search for Homologs in PDB

Top 10 Homologs in PDB (as of Nov 2020):

PDB	aa ident	species	PDB title
3C57	100%	Mycobacterium tuberculosis	Crystal Structure of the Mycobacterium tuberculosis Hypoxic Response Regulator DosR C-terminal Domain Crystal Form II
3C3W	100%	Mycobacterium tuberculosis	Crystal Structure of the Mycobacterium tuberculosis Hypoxic Response Regulator DosR
1ZLK	100%	Mycobacterium tuberculosis	Crystal Structure of the Mycobacterium tuberculosis Hypoxic Response Regulator DosR C-terminal Domain-DNA Complex
1ZLJ	100%	Mycobacterium tuberculosis	Crystal Structure of the Mycobacterium tuberculosis Hypoxic Response Regulator DosR C-terminal Domain
4WUL	49%	None	Crystal structure of E. faecalis DNA binding domain LiaRD191N complexed with 26bp DNA
4WUH	49%	Enterococcus faecalis S613	Crystal structure of E. faecalis DNA binding domain LiaR wild type complexed with 22bp DNA
4WU4	49%	None	Crystal structure of E. faecalis DNA binding domain LiaRD191N complexed with 22bp DNA
4WT0	49%	None	Crystal structure of the DNA binding domains of LiaRD191N from E. faecalis
4WSZ	49%	None	Crystal structure of the DNA binding domains of wild type LiaR from E. faecalis
1FSE	45%	Bacillus subtilis	CRYSTAL STRUCTURE OF THE BACILLUS SUBTILIS REGULATORY PROTEIN GERE

Links to additional information on devR:
- KEGG - nucleotide and amino acid sequences of gene
- Mycobrowser
- PATRIC
- BioCyc
- Systems Biology
- TBDB (updated)
- Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
- UniProt
- AlphaFold model
- Vulnerability = 1.549 (from Jeremy Rock's lab)

Amino Acid Sequence

VVKVFLVDDHEVVRRGLVDLLGADPELDVVGEAGSVAEAMARVPAARPDVAVLDVRLPDGNGIELCRDLLSRMPDLRCLILTSYTSDEAMLDAILAGASG
YVVKDIKGMELARAVKDVGAGRSLLDNRAAAALMAKLRGAAEKQDPLSGLTDQERTLLGLLSEGLTNKQIADRMFLAEKTVKNYVSRLLAKLGMERRTQA
AVFATELKRSRPPGDGP

(Nucleotide sequence available on KEGG)

Additional Information

dosR

ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across >100 conditions *new*

Classification	Condition	Strain	Method	Reference	Notes
Non-Essential	Sodium Oleate	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.000000; 2 non-insertions in a row out of 12 sites
Non-Essential	Lignoceric Acid	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.000000; 1 non-insertions in a row out of 12 sites
Non-Essential	Phosphatidylcholine	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.000000; 2 non-insertions in a row out of 12 sites
Non-Essential	minimal media + 0.1% glycerol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 0.000000; 2 non-insertions in a row out of 12 sites
Non-Essential	minimal media + 0.01% cholesterol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 0.000000; 2 non-insertions in a row out of 12 sites
Non-Essential	7H10-glycerol	H37RvMA	TraSH	Sassetti et al. (2003a)
Non-Essential	C57BL/6J mice (8 weeks)	H37RvMA	TraSH	Sassetti et al. (2003b)	Hybridization Ratio: 1.14
Non-Essential	7H09/7H10 + rich media	H37RvMA	MotifHMM	DeJesus et al. (2017)	Fully saturated (14 reps).

TnSeq Data No data currently available.

No TnSeq data currently available for this Target.

RNASeq Data No data currently available.

No RNA-Seq data currently available for this Target.

Metabolomic Profiles No data currently available.

No Metabolomic data currently available for this Target.

Proteomic Data No data currently available.

No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology

BioCyc

Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

Interactions based on ChIPSeq data

Interactions based on ChIPSeq data (Minch et al. 2014)

Binds To:
- Rv0010c (-) (Direct binding)
- Rv0011c (-) (Direct binding)
- Rv0012 (-) (Direct binding)
- Rv0042c (-) (Direct binding)
- Rv0050 (ponA1) (Direct binding)
- Rv0079 (-) (Direct binding)
- Rv0107c (ctpI) (Direct binding)
- Rv0116c (ldtA) (Direct binding)
- Rv0117 (oxyS) (Direct binding)
- Rv0157A (-) (Direct binding)
- Rv0158 (-) (Direct binding)
- Rv0167 (yrbE1A) (Direct binding)
- Rv0172 (mce1D) (Direct binding)
- Rv0228 (-) (Direct binding)
- Rv0242c (fabG4) (Direct binding)
- Rv0243 (fadA2) (Direct binding)
- Rv0253 (nirD) (Direct binding)
- Rv0287 (esxG) (Direct binding)
- Rv0318c (-) (Direct binding)
- Rv0319 (pcp) (Direct binding)
- Rv0356c (-) (Direct binding)
- Rv0378 (-) (Direct binding)
- Rv0392c (ndhA) (Direct binding)
- Rv0393 (-) (Direct binding)
- Rv0405 (pks6) (Direct binding)
- Rv0456A (mazF1) (Direct binding)
- Rv0456c (echA2) (Direct binding)
- Rv0548c (menB) (Direct binding)
- Rv0566c (-) (Direct binding)
- Rv0569 (-) (Direct binding)
- Rv0570 (nrdZ) (Direct binding)
- Rv0571c (-) (Direct binding)
- Rv0572c (-) (Direct binding)
- Rv0609A (-) (Direct binding)
- Rv0634A (-) (Direct binding)
- Rv0634c (-) (Direct binding)
- Rv0640 (rplK) (Direct binding)
- Rv0668 (rpoC) (Direct binding)
- Rv0681 (-) (Direct binding)
- Rv0683 (rpsG) (Direct binding)
- Rv0774c (-) (Direct binding)
- Rv0842 (-) (Direct binding)
- Rv0876c (-) (Direct binding)
- Rv0877 (-) (Direct binding)
- Rv0881 (-) (Direct binding)
- Rv0889c (citA) (Direct binding)
- Rv1018c (glmU) (Direct binding)
- Rv1019 (-) (Direct binding)
- Rv1035c (-) (Direct binding)
- Rv1036c (-) (Direct binding)
- Rv1064c (lpqV) (Direct binding)
- Rv1065 (-) (Direct binding)
- Rv1116 (-) (Direct binding)
- Rv1129c (-) (Direct binding)
- Rv1130 (prpD) (Direct binding)
- Rv1169c (lipX) (Direct binding)
- Rv1170 (mshB) (Direct binding)
- Rv1221 (sigE) (Direct binding)
- Rv1244 (lpqZ) (Direct binding)
- Rv1336 (cysM) (Direct binding)
- Rv1339 (-) (Direct binding)
- Rv1340 (rphA) (Direct binding)
- Rv1359 (-) (Direct binding)
- Rv1392 (metK) (Direct binding)
- Rv1405c (-) (Direct binding)
- Rv1523 (-) (Direct binding)
- Rv1541c (lprI) (Direct binding)
- Rv1552 (frdA) (Direct binding)
- Rv1572c (-) (Direct binding)
- Rv1573 (-) (Direct binding)
- Rv1651c (PE_PGRS30) (Direct binding)
- Rv1652 (argC) (Direct binding)
- Rv1734c (-) (Direct binding)
- Rv1738 (-) (Direct binding)
- Rv1818c (PE_PGRS33) (Direct binding)
- Rv1824 (-) (Direct binding)
- Rv1886c (fbpB) (Direct binding)
- Rv1953 (vapC14) (Direct binding)
- Rv1954c (-) (Direct binding)
- Rv1977 (-) (Direct binding)
- Rv1985c (-) (Direct binding)
- Rv1986 (-) (Direct binding)
- Rv1996 (-) (Direct binding)
- Rv1997 (ctpF) (Direct binding)
- Rv2005c (-) (Direct binding)
- Rv2006 (otsB1) (Direct binding)
- Rv2007c (fdxA) (Direct binding)
- Rv2023c (-) (Direct binding)
- Rv2031c (hspX) (Direct binding)
- Rv2032 (acg) (Direct binding)
- Rv2034 (-) (Direct binding)
- Rv2036 (-) (Direct binding)
- Rv2038c (-) (Direct binding)
- Rv2107 (PE22) (Direct binding)
- Rv2108 (PPE36) (Direct binding)
- Rv2188c (pimB) (Direct binding)
- Rv2286c (-) (Direct binding)
- Rv2287 (yjcE) (Direct binding)
- Rv2300c (-) (Direct binding)
- Rv2301 (cut2) (Direct binding)
- Rv2307A (-) (Direct binding)
- Rv2307B (-) (Direct binding)
- Rv2336 (-) (Direct binding)
- Rv2347c (esxP) (Direct binding)
- Rv2366c (-) (Direct binding)
- Rv2370c (-) (Direct binding)
- Rv2421c (nadD) (Direct binding)
- Rv2462c (tig) (Direct binding)
- Rv2463 (lipP) (Direct binding)
- Rv2520c (-) (Direct binding)
- Rv2521 (bcp) (Direct binding)
- Rv2591 (PE_PGRS44) (Direct binding)
- Rv2621c (-) (Direct binding)
- Rv2622 (-) (Direct binding)
- Rv2623 (TB31.7) (Direct binding)
- Rv2626c (hrp1) (Direct binding)
- Rv2628 (-) (Direct binding)
- Rv2629 (-) (Direct binding)
- Rv2634c (PE_PGRS46) (Direct binding)
- Rv2635 (-) (Direct binding)
- Rv2708c (-) (Direct binding)
- Rv2709 (-) (Direct binding)
- Rv2779c (-) (Direct binding)
- Rv2780 (ald) (Direct binding)
- Rv2795c (-) (Direct binding)
- Rv2807 (-) (Direct binding)
- Rv2816c (-) (Direct binding)
- Rv2907c (rimM) (Direct binding)
- Rv2914c (pknI) (Direct binding)
- Rv2922c (smc) (Direct binding)
- Rv2951c (-) (Direct binding)
- Rv2952 (-) (Direct binding)
- Rv2965c (kdtB) (Direct binding)
- Rv3006 (lppZ) (Direct binding)
- Rv3007c (-) (Direct binding)
- Rv3088 (tgs4) (Direct binding)
- Rv3096 (-) (Direct binding)
- Rv3117 (cysA3) (Direct binding)
- Rv3120 (-) (Direct binding)
- Rv3125c (PPE49) (Direct binding)
- Rv3126c (-) (Direct binding)
- Rv3127 (-) (Direct binding)
- Rv3130c (tgs1) (Direct binding)
- Rv3131 (-) (Direct binding)
- Rv3134c (-) (Direct binding)
- Rv3136 (PPE51) (Direct binding)
- Rv3142c (-) (Direct binding)
- Rv3143 (-) (Direct binding)
- Rv3179 (-) (Direct binding)
- Rv3188 (-) (Direct binding)
- Rv3248c (sahH) (Direct binding)
- Rv3350c (PPE56) (Direct binding)
- Rv3351c (-) (Direct binding)
- Rv3354 (-) (Direct binding)
- Rv3385c (vapB46) (Direct binding)
- Rv3386 (-) (Direct binding)
- Rv3459c (rpsK) (Direct binding)
- Rv3494c (mce4F) (Direct binding)
- Rv3545c (cyp125) (Direct binding)
- Rv3546 (fadA5) (Direct binding)
- Rv3556c (fadA6) (Direct binding)
- Rv3568c (hsaC) (Direct binding)
- Rv3595c (PE_PGRS59) (Direct binding)
- Rv3616c (espA) (Direct binding)
- Rv3737 (-) (Direct binding)
- Rv3741c (-) (Direct binding)
- Rv3777 (-) (Direct binding)
- Rv3812 (PE_PGRS62) (Direct binding)
- Rv3824c (papA1) (Direct binding)
- Rv3859c (gltB) (Direct binding)
- Rv3916c (-) (Direct binding)
- Rv3922c (-) (Direct binding)
- Rv3923c (rnpA) (Direct binding)
- Rv0013 (trpG) (Upstream of operon)
- Rv0051 (-) (Upstream of operon)
- Rv0052 (-) (Upstream of operon)
- Rv0080 (-) (Upstream of operon)
- Rv0168 (yrbE1B) (Upstream of operon)
- Rv0169 (mce1A) (Upstream of operon)
- Rv0170 (mce1B) (Upstream of operon)
- Rv0171 (mce1C) (Upstream of operon)
- Rv0173 (lprK) (Upstream of operon)
- Rv0174 (mce1F) (Upstream of operon)
- Rv0175 (-) (Upstream of operon)
- Rv0176 (-) (Upstream of operon)
- Rv0177 (-) (Upstream of operon)
- Rv0178 (-) (Upstream of operon)
- Rv0241c (htdX) (Upstream of operon)
- Rv0288 (esxH) (Upstream of operon)
- Rv0289 (espG3) (Upstream of operon)
- Rv0843 (-) (Upstream of operon)
- Rv0875c (-) (Upstream of operon)
- Rv1066 (-) (Upstream of operon)
- Rv1131 (prpC) (Upstream of operon)
- Rv1132 (-) (Upstream of operon)
- Rv1168c (PPE17) (Upstream of operon)
- Rv1524 (-) (Upstream of operon)
- Rv1553 (frdB) (Upstream of operon)
- Rv1554 (frdC) (Upstream of operon)
- Rv1555 (frdD) (Upstream of operon)
- Rv1653 (argJ) (Upstream of operon)
- Rv1654 (argB) (Upstream of operon)
- Rv1655 (argD) (Upstream of operon)
- Rv1656 (argF) (Upstream of operon)
- Rv1657 (argR) (Upstream of operon)
- Rv1658 (argG) (Upstream of operon)
- Rv1882c (-) (Upstream of operon)
- Rv1883c (-) (Upstream of operon)
- Rv1884c (rpfC) (Upstream of operon)
- Rv1885c (-) (Upstream of operon)
- Rv2004c (-) (Upstream of operon)
- Rv2028c (-) (Upstream of operon)
- Rv2029c (pfkB) (Upstream of operon)
- Rv2030c (-) (Upstream of operon)
- Rv2035 (-) (Upstream of operon)
- Rv2288 (-) (Upstream of operon)
- Rv2289 (cdh) (Upstream of operon)
- Rv2365c (-) (Upstream of operon)
- Rv2367c (-) (Upstream of operon)
- Rv2368c (phoH1) (Upstream of operon)
- Rv2369c (-) (Upstream of operon)
- Rv2418c (-) (Upstream of operon)
- Rv2419c (gpgP) (Upstream of operon)
- Rv2420c (-) (Upstream of operon)
- Rv2619c (-) (Upstream of operon)
- Rv2620c (-) (Upstream of operon)
- Rv2630 (-) (Upstream of operon)
- Rv2636 (-) (Upstream of operon)
- Rv2778c (-) (Upstream of operon)
- Rv2793c (truB) (Upstream of operon)
- Rv2794c (pptT) (Upstream of operon)
- Rv2953 (-) (Upstream of operon)
- Rv3132c (devS) (Upstream of operon)
- Rv3133c (devR) (Upstream of operon)
- Rv3189 (-) (Upstream of operon)
- Rv3384c (vapC46) (Upstream of operon)
- Rv3387 (-) (Upstream of operon)
- Rv3540c (ltp2) (Upstream of operon)
- Rv3541c (-) (Upstream of operon)
- Rv3542c (-) (Upstream of operon)
- Rv3543c (fadE29) (Upstream of operon)
- Rv3544c (fadE28) (Upstream of operon)
- Rv3858c (gltD) (Upstream of operon)
Bound By:
- Rv1353c (-) (Direct binding)
- Rv2034 (-) (Direct binding)
- Rv1985c (-) (Upstream of operon)
- Rv3133c (devR) (Upstream of operon)

Interactions based on TFOE data (Rustad et al. 2014)

TBCAP

Tubculosis Community Annotation Project (

Slayden et al., 2013

Rv3133c (devR)

Property	Value	Creator	Evidence	PMID	Comment
Interaction	Regulatory Rv3690	priyadarshinipriyanka2001	IEP		Co-expression (Functional linkage) SL. Kendall, F. Movahedzadeh et al. The Mycobacterium tuberculosis dosRS two-component system is induced by multiple stresses. Tuberculosis (Edinburgh, Scotland) 2004
Interaction	Regulatory Rv3690	aparna.vchalam	IEP		Co-expression (Functional linkage) SL. Kendall, F. Movahedzadeh et al. The Mycobacterium tuberculosis dosRS two-component system is induced by multiple stresses. Tuberculosis (Edinburgh, Scotland) 2004
Interaction	Regulatory Rv3143	shahanup86	IEP		Co-expression (Functional linkage) SL. Kendall, F. Movahedzadeh et al. The Mycobacterium tuberculosis dosRS two-component system is induced by multiple stresses. Tuberculosis (Edinburgh, Scotland) 2004
Interaction	PhysicalInteraction Rv3134c	kaveri.verma	IPI		Affinity purification (Physical interaction) G. Bagchi, null. Mayuri et al. Hypoxia-responsive expression of Mycobacterium tuberculosis Rv3134c and devR promoters in Mycobacterium smegmatis. Microbiology (Reading, Engl.) 2003
Interaction	PhysicalInteraction Rv3134c	kaveri.verma	IPI		Affinity purification (Physical interaction) null. Mayuri, G. Bagchi et al. Molecular analysis of the dormancy response in Mycobacterium smegmatis: expression analysis of genes encoding the DevR-DevS two-component system, Rv3134c and chaperone alpha-crystallin homologues. FEMS Microbiol. Lett. 2002
Interaction	PhysicalInteraction Rv3134c	kaveri.verma	IPI		Affinity purification (Physical interaction) PJ. Converse, PC. Karakousis et al. The role of the dosR/dosS two-component regulatory system in Mycobacterium tuberculosis virulence in three animal models. Infect. Immun. 2008
Interaction	PhysicalInteraction Rv3134c	kaveri.verma	IPI		Affinity purification (Physical interaction) JG. Rodriguez, CS. Burbano et al. Rv3134c/devR/devS operon of Mycobacterium bovis BCG is differentially transcribed under in vitro stress conditions. Tuberculosis (Edinburgh, Scotland) 2008
Citation	Mycobacterium tuberculosis DosS is a redox sensor and DosT is a hypoxia sensor. A. Kumar,JC. Toledo,RP. Patel,JR. Lancaster,AJ. Steyn Proc. Natl. Acad. Sci. U.S.A. 2007	jhum4u2006	IEP	17609369	Co-occurrence (Functional linkage)
Interaction	Regulatory Rv3132c	jhum4u2006	IEP		Co-occurrence (Functional linkage) A. Kumar,JC. Toledo,RP. Patel,JR. Lancaster,AJ. Steyn Mycobacterium tuberculosis DosS is a redox sensor and DosT is a hypoxia sensor. Proc. Natl. Acad. Sci. U.S.A. 2007
Interaction	PhysicalInteraction Rv3134c	kaveri.verma	IPI		Affinity purification (Physical interaction) S. Chauhan & JS. Tyagi Cooperative binding of phosphorylated DevR to upstream sites is necessary and sufficient for activation of the Rv3134c-devRS operon in Mycobacterium tuberculosis: implication in the induction of DevR target genes. J. Bacteriol. 2008
Citation	Comprehensive proteomic profiling of the membrane constituents of a Mycobacterium tuberculosis strain. authors,S. Gu,J. Chen,KM. Dobos,EM. Bradbury,JT. Belisle,X. Chen Mol. Cell Proteomics 2003	jhum4u2006	IEP	14532352	Co-occurrence (Functional linkage)
Interaction	Regulatory Rv3132c	jhum4u2006	IEP		Co-occurrence (Functional linkage) authors,S. Gu,J. Chen,KM. Dobos,EM. Bradbury,JT. Belisle,X. Chen Comprehensive proteomic profiling of the membrane constituents of a Mycobacterium tuberculosis strain. Mol. Cell Proteomics 2003
Citation	Two sensor kinases contribute to the hypoxic response of Mycobacterium tuberculosis. DM. Roberts, RP. Liao et al. J. Biol. Chem. 2004	jhum4u2006	IEP	15033981	Co-occurrence (Functional linkage)
Interaction	Regulatory Rv3132c	jhum4u2006	IEP		Co-occurrence (Functional linkage) DM. Roberts, RP. Liao et al. Two sensor kinases contribute to the hypoxic response of Mycobacterium tuberculosis. J. Biol. Chem. 2004
Citation	DevR-DevS is a bona fide two-component system of Mycobacterium tuberculosis that is hypoxia-responsive in the absence of the DNA-binding domain of DevR. DK. Saini, V. Malhotra et al. Microbiology (Reading, Engl.) 2004	jhum4u2006	IEP	15073296	Co-occurrence (Functional linkage)
Interaction	Regulatory Rv3132c	jhum4u2006	IEP		Co-occurrence (Functional linkage) DK. Saini, V. Malhotra et al. DevR-DevS is a bona fide two-component system of Mycobacterium tuberculosis that is hypoxia-responsive in the absence of the DNA-binding domain of DevR. Microbiology (Reading, Engl.) 2004
Citation	A GAF domain in the hypoxia/NO-inducible Mycobacterium tuberculosis DosS protein binds haem. S. Sardiwal,SL. Kendall,F. Movahedzadeh,SC. Rison,NG. Stoker,S. Djordjevic J. Mol. Biol. 2005	jhum4u2006	IEP	16213520	Co-occurrence (Functional linkage)
Interaction	Regulatory Rv3132c	jhum4u2006	IEP		Co-occurrence (Functional linkage) S. Sardiwal,SL. Kendall,F. Movahedzadeh,SC. Rison,NG. Stoker,S. Djordjevic A GAF domain in the hypoxia/NO-inducible Mycobacterium tuberculosis DosS protein binds haem. J. Mol. Biol. 2005
Citation	DosT and DevS are oxygen-switched kinases in Mycobacterium tuberculosis. EH. Sousa, JR. Tuckerman et al. Protein Sci. 2007	jhum4u2006	IEP	17600145	Co-occurrence (Functional linkage)
Interaction	Regulatory Rv3132c	jhum4u2006	IEP		Co-occurrence (Functional linkage) EH. Sousa, JR. Tuckerman et al. DosT and DevS are oxygen-switched kinases in Mycobacterium tuberculosis. Protein Sci. 2007
Interaction	Regulatory Rv3132c	jhum4u2006	IEP		Co-occurrence (Functional linkage) authors,JC. Betts,PT. Lukey,LC. Robb,RA. McAdam,K. Duncan Evaluation of a nutrient starvation model of Mycobacterium tuberculosis persistence by gene and protein expression profiling. Mol. Microbiol. 2002
Citation	Molecular analysis of the dormancy response in Mycobacterium smegmatis: expression analysis of genes encoding the DevR-DevS two-component system, Rv3134c and chaperone alpha-crystallin homologues. null. Mayuri, G. Bagchi et al. FEMS Microbiol. Lett. 2002	jhum4u2006	IEP	12076818	Co-occurrence (Functional linkage)
Interaction	Regulatory Rv3132c	jhum4u2006	IEP		Co-occurrence (Functional linkage) null. Mayuri, G. Bagchi et al. Molecular analysis of the dormancy response in Mycobacterium smegmatis: expression analysis of genes encoding the DevR-DevS two-component system, Rv3134c and chaperone alpha-crystallin homologues. FEMS Microbiol. Lett. 2002
Citation	Cloning, overexpression, purification, and matrix-assisted refolding of DevS (Rv 3132c) histidine protein kinase of Mycobacterium tuberculosis. DK. Saini, N. Pant et al. Protein Expr. Purif. 2002	jhum4u2006	IEP	12071717	Co-occurrence (Functional linkage)
Interaction	Regulatory Rv3132c	jhum4u2006	IEP		Co-occurrence (Functional linkage) DK. Saini, N. Pant et al. Cloning, overexpression, purification, and matrix-assisted refolding of DevS (Rv 3132c) histidine protein kinase of Mycobacterium tuberculosis. Protein Expr. Purif. 2002
Citation	Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. HD. Park, KM. Guinn et al. Mol. Microbiol. 2003	jhum4u2006	IEP	12694625	Co-occurrence (Functional linkage)
Interaction	Regulatory Rv3132c	jhum4u2006	IEP		Co-occurrence (Functional linkage) HD. Park, KM. Guinn et al. Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. Mol. Microbiol. 2003
Citation	Inhibition of respiration by nitric oxide induces a Mycobacterium tuberculosis dormancy program. MI. Voskuil, D. Schnappinger et al. J. Exp. Med. 2003	jhum4u2006	IEP	12953092	Co-occurrence (Functional linkage)
Interaction	Regulatory Rv3132c	jhum4u2006	IEP		Co-occurrence (Functional linkage) MI. Voskuil, D. Schnappinger et al. Inhibition of respiration by nitric oxide induces a Mycobacterium tuberculosis dormancy program. J. Exp. Med. 2003
Interaction	Regulatory Rv3132c	hibeeluck	IEP		Co-occurrence (Functional linkage) A. Kumar,JC. Toledo,RP. Patel,JR. Lancaster,AJ. Steyn Mycobacterium tuberculosis DosS is a redox sensor and DosT is a hypoxia sensor. Proc. Natl. Acad. Sci. U.S.A. 2007
Citation	Structural insight into the heme-based redox sensing by DosS from Mycobacterium tuberculosis. HY. Cho,HJ. Cho,YM. Kim,JI. Oh,BS. Kang J. Biol. Chem. 2009	jhum4u2006	IEP	19276084	Co-occurrence (Functional linkage)
Interaction	Regulatory Rv3132c	jhum4u2006	IEP		Co-occurrence (Functional linkage) HY. Cho,HJ. Cho,YM. Kim,JI. Oh,BS. Kang Structural insight into the heme-based redox sensing by DosS from Mycobacterium tuberculosis. J. Biol. Chem. 2009
Citation	The role of the dosR/dosS two-component regulatory system in Mycobacterium tuberculosis virulence in three animal models. PJ. Converse, PC. Karakousis et al. Infect. Immun. 2008	jhum4u2006	IEP	19103767	Co-occurrence (Functional linkage)
Interaction	Regulatory Rv3132c	jhum4u2006	IEP		Co-occurrence (Functional linkage) PJ. Converse, PC. Karakousis et al. The role of the dosR/dosS two-component regulatory system in Mycobacterium tuberculosis virulence in three animal models. Infect. Immun. 2008
Citation	Regulation of the Mycobacterium tuberculosis hypoxic response gene encoding alpha -crystallin. DR. Sherman, M. Voskuil et al. Proc. Natl. Acad. Sci. U.S.A. 2001	jhum4u2006	IEP	11416222	Co-occurrence (Functional linkage)
Interaction	Regulatory Rv3132c	jhum4u2006	IEP		Co-occurrence (Functional linkage) DR. Sherman, M. Voskuil et al. Regulation of the Mycobacterium tuberculosis hypoxic response gene encoding alpha -crystallin. Proc. Natl. Acad. Sci. U.S.A. 2001
Citation	Characterization of a two-component system, devR-devS, of Mycobacterium tuberculosis. N. Dasgupta, V. Kapur et al. Tuber. Lung Dis. 2000	jhum4u2006	IEP	10970762	Co-occurrence (Functional linkage)
Interaction	Regulatory Rv3132c	jhum4u2006	IEP		Co-occurrence (Functional linkage) N. Dasgupta, V. Kapur et al. Characterization of a two-component system, devR-devS, of Mycobacterium tuberculosis. Tuber. Lung Dis. 2000
Citation	Evaluation of a nutrient starvation model of Mycobacterium tuberculosis persistence by gene and protein expression profiling. authors,JC. Betts,PT. Lukey,LC. Robb,RA. McAdam,K. Duncan Mol. Microbiol. 2002	jhum4u2006	IEP	11929527	Co-occurrence (Functional linkage)
Interaction	Regulatory Rv3132c	hibeeluck	IEP		Co-occurrence (Functional linkage) authors,S. Gu,J. Chen,KM. Dobos,EM. Bradbury,JT. Belisle,X. Chen Comprehensive proteomic profiling of the membrane constituents of a Mycobacterium tuberculosis strain. Mol. Cell Proteomics 2003
Citation	Two sensor kinases contribute to the hypoxic response of Mycobacterium tuberculosis. DM. Roberts, RP. Liao et al. J. Biol. Chem. 2004	hibeeluck	IEP	15033981	Co-occurrence (Functional linkage)
Interaction	Regulatory Rv3132c	hibeeluck	IEP		Co-occurrence (Functional linkage) DM. Roberts, RP. Liao et al. Two sensor kinases contribute to the hypoxic response of Mycobacterium tuberculosis. J. Biol. Chem. 2004
Citation	DevR-DevS is a bona fide two-component system of Mycobacterium tuberculosis that is hypoxia-responsive in the absence of the DNA-binding domain of DevR. DK. Saini, V. Malhotra et al. Microbiology (Reading, Engl.) 2004	hibeeluck	IEP	15073296	Co-occurrence (Functional linkage)
Interaction	Regulatory Rv3132c	hibeeluck	IEP		Co-occurrence (Functional linkage) DK. Saini, V. Malhotra et al. DevR-DevS is a bona fide two-component system of Mycobacterium tuberculosis that is hypoxia-responsive in the absence of the DNA-binding domain of DevR. Microbiology (Reading, Engl.) 2004
Citation	A GAF domain in the hypoxia/NO-inducible Mycobacterium tuberculosis DosS protein binds haem. S. Sardiwal,SL. Kendall,F. Movahedzadeh,SC. Rison,NG. Stoker,S. Djordjevic J. Mol. Biol. 2005	hibeeluck	IEP	16213520	Co-occurrence (Functional linkage)
Interaction	Regulatory Rv3132c	hibeeluck	IEP		Co-occurrence (Functional linkage) S. Sardiwal,SL. Kendall,F. Movahedzadeh,SC. Rison,NG. Stoker,S. Djordjevic A GAF domain in the hypoxia/NO-inducible Mycobacterium tuberculosis DosS protein binds haem. J. Mol. Biol. 2005
Citation	DosT and DevS are oxygen-switched kinases in Mycobacterium tuberculosis. EH. Sousa, JR. Tuckerman et al. Protein Sci. 2007	hibeeluck	IEP	17600145	Co-occurrence (Functional linkage)
Interaction	Regulatory Rv3132c	hibeeluck	IEP		Co-occurrence (Functional linkage) EH. Sousa, JR. Tuckerman et al. DosT and DevS are oxygen-switched kinases in Mycobacterium tuberculosis. Protein Sci. 2007
Citation	Mycobacterium tuberculosis DosS is a redox sensor and DosT is a hypoxia sensor. A. Kumar,JC. Toledo,RP. Patel,JR. Lancaster,AJ. Steyn Proc. Natl. Acad. Sci. U.S.A. 2007	hibeeluck	IEP	17609369	Co-occurrence (Functional linkage)
Citation	Molecular analysis of the dormancy response in Mycobacterium smegmatis: expression analysis of genes encoding the DevR-DevS two-component system, Rv3134c and chaperone alpha-crystallin homologues. null. Mayuri, G. Bagchi et al. FEMS Microbiol. Lett. 2002	hibeeluck	IEP	12076818	Co-occurrence (Functional linkage)
Interaction	Regulatory Rv3132c	hibeeluck	IEP		Co-occurrence (Functional linkage) null. Mayuri, G. Bagchi et al. Molecular analysis of the dormancy response in Mycobacterium smegmatis: expression analysis of genes encoding the DevR-DevS two-component system, Rv3134c and chaperone alpha-crystallin homologues. FEMS Microbiol. Lett. 2002
Citation	Cloning, overexpression, purification, and matrix-assisted refolding of DevS (Rv 3132c) histidine protein kinase of Mycobacterium tuberculosis. DK. Saini, N. Pant et al. Protein Expr. Purif. 2002	hibeeluck	IEP	12071717	Co-occurrence (Functional linkage)
Interaction	Regulatory Rv3132c	hibeeluck	IEP		Co-occurrence (Functional linkage) DK. Saini, N. Pant et al. Cloning, overexpression, purification, and matrix-assisted refolding of DevS (Rv 3132c) histidine protein kinase of Mycobacterium tuberculosis. Protein Expr. Purif. 2002
Citation	Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. HD. Park, KM. Guinn et al. Mol. Microbiol. 2003	hibeeluck	IEP	12694625	Co-occurrence (Functional linkage)
Interaction	Regulatory Rv3132c	hibeeluck	IEP		Co-occurrence (Functional linkage) HD. Park, KM. Guinn et al. Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. Mol. Microbiol. 2003
Citation	Inhibition of respiration by nitric oxide induces a Mycobacterium tuberculosis dormancy program. MI. Voskuil, D. Schnappinger et al. J. Exp. Med. 2003	hibeeluck	IEP	12953092	Co-occurrence (Functional linkage)
Interaction	Regulatory Rv3132c	hibeeluck	IEP		Co-occurrence (Functional linkage) MI. Voskuil, D. Schnappinger et al. Inhibition of respiration by nitric oxide induces a Mycobacterium tuberculosis dormancy program. J. Exp. Med. 2003
Citation	Comprehensive proteomic profiling of the membrane constituents of a Mycobacterium tuberculosis strain. authors,S. Gu,J. Chen,KM. Dobos,EM. Bradbury,JT. Belisle,X. Chen Mol. Cell Proteomics 2003	hibeeluck	IEP	14532352	Co-occurrence (Functional linkage)
Interaction	Regulatory Rv3132c	jhum4u2006	IEP		Affinity purification (Physical interaction) A. Kumar,JC. Toledo,RP. Patel,JR. Lancaster,AJ. Steyn Mycobacterium tuberculosis DosS is a redox sensor and DosT is a hypoxia sensor. Proc. Natl. Acad. Sci. U.S.A. 2007
Citation	Structural insight into the heme-based redox sensing by DosS from Mycobacterium tuberculosis. HY. Cho,HJ. Cho,YM. Kim,JI. Oh,BS. Kang J. Biol. Chem. 2009	hibeeluck	IEP	19276084	Co-occurrence (Functional linkage)
Interaction	Regulatory Rv3132c	hibeeluck	IEP		Co-occurrence (Functional linkage) HY. Cho,HJ. Cho,YM. Kim,JI. Oh,BS. Kang Structural insight into the heme-based redox sensing by DosS from Mycobacterium tuberculosis. J. Biol. Chem. 2009
Citation	The role of the dosR/dosS two-component regulatory system in Mycobacterium tuberculosis virulence in three animal models. PJ. Converse, PC. Karakousis et al. Infect. Immun. 2008	hibeeluck	IEP	19103767	Co-occurrence (Functional linkage)
Interaction	Regulatory Rv3132c	hibeeluck	IEP		Co-occurrence (Functional linkage) PJ. Converse, PC. Karakousis et al. The role of the dosR/dosS two-component regulatory system in Mycobacterium tuberculosis virulence in three animal models. Infect. Immun. 2008
Citation	Regulation of the Mycobacterium tuberculosis hypoxic response gene encoding alpha -crystallin. DR. Sherman, M. Voskuil et al. Proc. Natl. Acad. Sci. U.S.A. 2001	hibeeluck	IEP	11416222	Co-occurrence (Functional linkage)
Interaction	Regulatory Rv3132c	hibeeluck	IEP		Co-occurrence (Functional linkage) DR. Sherman, M. Voskuil et al. Regulation of the Mycobacterium tuberculosis hypoxic response gene encoding alpha -crystallin. Proc. Natl. Acad. Sci. U.S.A. 2001
Citation	Characterization of a two-component system, devR-devS, of Mycobacterium tuberculosis. N. Dasgupta, V. Kapur et al. Tuber. Lung Dis. 2000	hibeeluck	IEP	10970762	Co-occurrence (Functional linkage)
Interaction	Regulatory Rv3132c	hibeeluck	IEP		Co-occurrence (Functional linkage) N. Dasgupta, V. Kapur et al. Characterization of a two-component system, devR-devS, of Mycobacterium tuberculosis. Tuber. Lung Dis. 2000
Citation	Evaluation of a nutrient starvation model of Mycobacterium tuberculosis persistence by gene and protein expression profiling. authors,JC. Betts,PT. Lukey,LC. Robb,RA. McAdam,K. Duncan Mol. Microbiol. 2002	hibeeluck	IEP	11929527	Co-occurrence (Functional linkage)
Interaction	Regulatory Rv3132c	hibeeluck	IEP		Co-occurrence (Functional linkage) authors,JC. Betts,PT. Lukey,LC. Robb,RA. McAdam,K. Duncan Evaluation of a nutrient starvation model of Mycobacterium tuberculosis persistence by gene and protein expression profiling. Mol. Microbiol. 2002
Interaction	Regulatory Rv3132c	jhum4u2006	IEP		Affinity purification (Physical interaction) DM. Roberts, RP. Liao et al. Two sensor kinases contribute to the hypoxic response of Mycobacterium tuberculosis. J. Biol. Chem. 2004
Interaction	Regulatory Rv3132c	jhum4u2006	IEP		Affinity purification (Physical interaction) DK. Saini, V. Malhotra et al. DevR-DevS is a bona fide two-component system of Mycobacterium tuberculosis that is hypoxia-responsive in the absence of the DNA-binding domain of DevR. Microbiology (Reading, Engl.) 2004
Interaction	Regulatory Rv3132c	jhum4u2006	IEP		Affinity purification (Physical interaction) S. Sardiwal,SL. Kendall,F. Movahedzadeh,SC. Rison,NG. Stoker,S. Djordjevic A GAF domain in the hypoxia/NO-inducible Mycobacterium tuberculosis DosS protein binds haem. J. Mol. Biol. 2005
Interaction	Regulatory Rv3132c	jhum4u2006	IEP		Affinity purification (Physical interaction) EH. Sousa, JR. Tuckerman et al. DosT and DevS are oxygen-switched kinases in Mycobacterium tuberculosis. Protein Sci. 2007
Interaction	Regulatory Rv3132c	jhum4u2006	IEP		Affinity purification (Physical interaction) null. Mayuri, G. Bagchi et al. Molecular analysis of the dormancy response in Mycobacterium smegmatis: expression analysis of genes encoding the DevR-DevS two-component system, Rv3134c and chaperone alpha-crystallin homologues. FEMS Microbiol. Lett. 2002
Interaction	Regulatory Rv3132c	jhum4u2006	IEP		Affinity purification (Physical interaction) DK. Saini, N. Pant et al. Cloning, overexpression, purification, and matrix-assisted refolding of DevS (Rv 3132c) histidine protein kinase of Mycobacterium tuberculosis. Protein Expr. Purif. 2002
Interaction	Regulatory Rv3132c	jhum4u2006	IEP		Affinity purification (Physical interaction) HD. Park, KM. Guinn et al. Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. Mol. Microbiol. 2003
Interaction	Regulatory Rv3132c	jhum4u2006	IEP		Affinity purification (Physical interaction) MI. Voskuil, D. Schnappinger et al. Inhibition of respiration by nitric oxide induces a Mycobacterium tuberculosis dormancy program. J. Exp. Med. 2003
Interaction	Regulatory Rv3132c	jhum4u2006	IEP		Affinity purification (Physical interaction) authors,S. Gu,J. Chen,KM. Dobos,EM. Bradbury,JT. Belisle,X. Chen Comprehensive proteomic profiling of the membrane constituents of a Mycobacterium tuberculosis strain. Mol. Cell Proteomics 2003
Interaction	Regulatory Rv3132c	jhum4u2006	IEP		Affinity purification (Physical interaction) HY. Cho,HJ. Cho,YM. Kim,JI. Oh,BS. Kang Structural insight into the heme-based redox sensing by DosS from Mycobacterium tuberculosis. J. Biol. Chem. 2009
Interaction	Regulatory Rv3132c	jhum4u2006	IEP		Affinity purification (Physical interaction) PJ. Converse, PC. Karakousis et al. The role of the dosR/dosS two-component regulatory system in Mycobacterium tuberculosis virulence in three animal models. Infect. Immun. 2008
Interaction	Regulatory Rv3132c	jhum4u2006	IEP		Affinity purification (Physical interaction) DR. Sherman, M. Voskuil et al. Regulation of the Mycobacterium tuberculosis hypoxic response gene encoding alpha -crystallin. Proc. Natl. Acad. Sci. U.S.A. 2001
Interaction	Regulatory Rv3132c	jhum4u2006	IEP		Affinity purification (Physical interaction) N. Dasgupta, V. Kapur et al. Characterization of a two-component system, devR-devS, of Mycobacterium tuberculosis. Tuber. Lung Dis. 2000
Interaction	Regulatory Rv3132c	jhum4u2006	IEP		Affinity purification (Physical interaction) authors,JC. Betts,PT. Lukey,LC. Robb,RA. McAdam,K. Duncan Evaluation of a nutrient starvation model of Mycobacterium tuberculosis persistence by gene and protein expression profiling. Mol. Microbiol. 2002
Interaction	Regulatory Rv3132c	hibeeluck	IEP		Affinity purification (Physical interaction) DK. Saini, V. Malhotra et al. DevR-DevS is a bona fide two-component system of Mycobacterium tuberculosis that is hypoxia-responsive in the absence of the DNA-binding domain of DevR. Microbiology (Reading, Engl.) 2004
Interaction	Regulatory Rv3132c	hibeeluck	IEP		Affinity purification (Physical interaction) S. Sardiwal,SL. Kendall,F. Movahedzadeh,SC. Rison,NG. Stoker,S. Djordjevic A GAF domain in the hypoxia/NO-inducible Mycobacterium tuberculosis DosS protein binds haem. J. Mol. Biol. 2005
Interaction	Regulatory Rv3132c	hibeeluck	IEP		Affinity purification (Physical interaction) EH. Sousa, JR. Tuckerman et al. DosT and DevS are oxygen-switched kinases in Mycobacterium tuberculosis. Protein Sci. 2007
Interaction	Regulatory Rv3132c	hibeeluck	IEP		Affinity purification (Physical interaction) A. Kumar,JC. Toledo,RP. Patel,JR. Lancaster,AJ. Steyn Mycobacterium tuberculosis DosS is a redox sensor and DosT is a hypoxia sensor. Proc. Natl. Acad. Sci. U.S.A. 2007
Interaction	Regulatory Rv3132c	hibeeluck	IEP		Affinity purification (Physical interaction) DK. Saini, N. Pant et al. Cloning, overexpression, purification, and matrix-assisted refolding of DevS (Rv 3132c) histidine protein kinase of Mycobacterium tuberculosis. Protein Expr. Purif. 2002
Interaction	Regulatory Rv3132c	hibeeluck	IEP		Affinity purification (Physical interaction) HD. Park, KM. Guinn et al. Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. Mol. Microbiol. 2003
Interaction	Regulatory Rv3132c	hibeeluck	IEP		Affinity purification (Physical interaction) MI. Voskuil, D. Schnappinger et al. Inhibition of respiration by nitric oxide induces a Mycobacterium tuberculosis dormancy program. J. Exp. Med. 2003
Interaction	Regulatory Rv3132c	hibeeluck	IEP		Affinity purification (Physical interaction) authors,S. Gu,J. Chen,KM. Dobos,EM. Bradbury,JT. Belisle,X. Chen Comprehensive proteomic profiling of the membrane constituents of a Mycobacterium tuberculosis strain. Mol. Cell Proteomics 2003
Interaction	Regulatory Rv3132c	hibeeluck	IEP		Affinity purification (Physical interaction) DM. Roberts, RP. Liao et al. Two sensor kinases contribute to the hypoxic response of Mycobacterium tuberculosis. J. Biol. Chem. 2004
Interaction	Regulatory Rv3132c	hibeeluck	IEP		Affinity purification (Physical interaction) PJ. Converse, PC. Karakousis et al. The role of the dosR/dosS two-component regulatory system in Mycobacterium tuberculosis virulence in three animal models. Infect. Immun. 2008
Interaction	Regulatory Rv3132c	hibeeluck	IEP		Affinity purification (Physical interaction) DR. Sherman, M. Voskuil et al. Regulation of the Mycobacterium tuberculosis hypoxic response gene encoding alpha -crystallin. Proc. Natl. Acad. Sci. U.S.A. 2001
Interaction	Regulatory Rv3132c	hibeeluck	IEP		Affinity purification (Physical interaction) N. Dasgupta, V. Kapur et al. Characterization of a two-component system, devR-devS, of Mycobacterium tuberculosis. Tuber. Lung Dis. 2000
Interaction	Regulatory Rv3132c	hibeeluck	IEP		Affinity purification (Physical interaction) authors,JC. Betts,PT. Lukey,LC. Robb,RA. McAdam,K. Duncan Evaluation of a nutrient starvation model of Mycobacterium tuberculosis persistence by gene and protein expression profiling. Mol. Microbiol. 2002
Interaction	Regulatory Rv3132c	hibeeluck	IEP		Affinity purification (Physical interaction) null. Mayuri, G. Bagchi et al. Molecular analysis of the dormancy response in Mycobacterium smegmatis: expression analysis of genes encoding the DevR-DevS two-component system, Rv3134c and chaperone alpha-crystallin homologues. FEMS Microbiol. Lett. 2002
Interaction	Regulatory Rv3129	kaveri.verma	IEP		Co-expression (Functional linkage) GF. Black,BA. Thiel,MO. Ota,SK. Parida,R. Adegbola,WH. Boom,HM. Dockrell,KL. Franken,AH. Friggen,PC. Hill,MR. Klein,MK. Lalor,H. Mayanja,G. Schoolnik,K. Stanley,K. Weldingh,SH. Kaufmann,G. Walzl,TH. Ottenhoff,null. null Immunogenicity of novel DosR regulon-encoded candidate antigens of Mycobacterium tuberculosis in three high-burden populations in Africa. Clin. Vaccine Immunol. 2009
Interaction	Regulatory Rv3130c	shahanup86	IEP		Co-expression (Functional linkage) S. Chauhan,JS. Tyagi Powerful induction of divergent tgs1-Rv3131 genes in Mycobacterium tuberculosis is mediated by DevR interaction with a high-affinity site and an adjacent cryptic low-affinity site. J. Bacteriol. 2009
Interaction	Regulatory Rv3131	shahanup86	IDA		Affinity purification (Physical interaction) S. Chauhan,JS. Tyagi Powerful induction of divergent tgs1-Rv3131 genes in Mycobacterium tuberculosis is mediated by DevR interaction with a high-affinity site and an adjacent cryptic low-affinity site. J. Bacteriol. 2009
Interaction	Regulatory Rv3132c	hibeeluck	IEP		Affinity purification (Physical interaction) HY. Cho,HJ. Cho,YM. Kim,JI. Oh,BS. Kang Structural insight into the heme-based redox sensing by DosS from Mycobacterium tuberculosis. J. Biol. Chem. 2009
Interaction	Regulatory Rv3129	kaveri.verma	IEP		Co-expression (Functional linkage) HD. Park, KM. Guinn et al. Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. Mol. Microbiol. 2003
Interaction	Transcription Rv2623	sourish10	IEP		Co-expression (Functional linkage) MA. Florczyk, LA. McCue et al. A family of acr-coregulated Mycobacterium tuberculosis genes shares a common DNA motif and requires Rv3133c (dosR or devR) for expression. Infect. Immun. 2003
Interaction	Regulatory Rv2625c	shruti4rana	NAS		GF. Black,BA. Thiel,MO. Ota,SK. Parida,R. Adegbola,WH. Boom,HM. Dockrell,KL. Franken,AH. Friggen,PC. Hill,MR. Klein,MK. Lalor,H. Mayanja,G. Schoolnik,K. Stanley,K. Weldingh,SH. Kaufmann,G. Walzl,TH. Ottenhoff,null. null Immunogenicity of novel DosR regulon-encoded candidate antigens of Mycobacterium tuberculosis in three high-burden populations in Africa. Clin. Vaccine Immunol. 2009
Interaction	Regulatory Rv2627c	shruti4rana	NAS		MY. Lin,TB. Reddy,SM. Arend,AH. Friggen,KL. Franken,KE. van Meijgaarden,MJ. Verduyn,GK. Schoolnik,MR. Klein,TH. Ottenhoff Cross-reactive immunity to Mycobacterium tuberculosis DosR regulon-encoded antigens in individuals infected with environmental, nontuberculous mycobacteria. Infect. Immun. 2009
Interaction	Transcription Rv2623	sourish10	IEP		Co-expression (Functional linkage) JE. Drumm, K. Mi et al. Mycobacterium tuberculosis universal stress protein Rv2623 regulates bacillary growth by ATP-Binding: requirement for establishing chronic persistent infection. PLoS Pathog. 2009
Interaction	Transcription Rv2623	sourish10	IEP		Co-expression (Functional linkage) authors,M. Seki,I. Honda,I. Fujita,I. Yano,S. Yamamoto,A. Koyama Whole genome sequence analysis of Mycobacterium bovis bacillus Calmette-Gurin (BCG) Tokyo 172: a comparative study of BCG vaccine substrains. Vaccine 2009
Interaction	Regulatory Rv2590	hibeeluck	IPI		Yeast one Hybrid J. Gonzalo-Asensio, S. Mostowy et al. PhoP: a missing piece in the intricate puzzle of Mycobacterium tuberculosis virulence. PLoS ONE 2008
Interaction	Regulatory Rv2590	hibeeluck	IPI		Yeast one Hybrid authors,KG. Mawuenyega,CV. Forst,KM. Dobos,JT. Belisle,J. Chen,EM. Bradbury,AR. Bradbury,X. Chen Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling. Mol. Biol. Cell 2005
Interaction	Regulatory Rv2590	hibeeluck	IPI		Yeast one Hybrid R. Manganelli, MI. Voskuil et al. The Mycobacterium tuberculosis ECF sigma factor sigmaE: role in global gene expression and survival in macrophages. Mol. Microbiol. 2001
Interaction	Regulatory Rv2590	hibeeluck	IPI		Yeast one Hybrid M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulatory Rv2255c	akankshajain.21	IEP		Co-expression (Functional Linkage) SL. Kendall, F. Movahedzadeh et al. The Mycobacterium tuberculosis dosRS two-component system is induced by multiple stresses. Tuberculosis (Edinburgh, Scotland) 2004
Interaction	Activates Rv2028c	priti.priety	IEP		Coexpression(Functional linkage) authors,IG. Alekseeva,GP. Lapina,ZD. Tulovskaia,VN. Izma-lova [Structure formation in interphase adsorption layers of lysozyme at liquid boundaries]. Biofizika null
Interaction	Signaling Rv2031c	priti.priety	IDA		affinity purification M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Signaling Rv2031c	priti.priety	IDA		affinity purification A. Demissie, EM. Leyten et al. Recognition of stage-specific mycobacterial antigens differentiates between acute and latent infections with Mycobacterium tuberculosis. Clin. Vaccine Immunol. 2006
Interaction	ActivatedBy Rv2027c	priti.priety	IDA		Band Shift DM. Roberts, RP. Liao et al. Two sensor kinases contribute to the hypoxic response of Mycobacterium tuberculosis. J. Biol. Chem. 2004
Interaction	Activates Rv2028c	priti.priety	IEP		Coexpression(Functional linkage) J. Starck, G. Kllenius et al. Comparative proteome analysis of Mycobacterium tuberculosis grown under aerobic and anaerobic conditions. Microbiology (Reading, Engl.) 2004
Interaction	Activates Rv2028c	priti.priety	IEP		Coexpression(Functional linkage) authors,BM. Altura Role of prostaglandins and histamine in reactive hyperemia: in-vivo studies on single mesenteric arterioles. Prostaglandins Med 1978
Interaction	Activates Rv2026c	priti.priety	IEP		Coexpression(Functional linkage) authors,BM. Altura Role of prostaglandins and histamine in reactive hyperemia: in-vivo studies on single mesenteric arterioles. Prostaglandins Med 1978
Interaction	Activates Rv2026c	priti.priety	IEP		Coexpression(Functional linkage) authors,IG. Alekseeva,GP. Lapina,ZD. Tulovskaia,VN. Izma-lova [Structure formation in interphase adsorption layers of lysozyme at liquid boundaries]. Biofizika null
Interaction	ActivatedBy Rv2027c	priti.priety	IDA		Band Shift DK. Saini, V. Malhotra et al. Cross talk between DevS sensor kinase homologue, Rv2027c, and DevR response regulator of Mycobacterium tuberculosis. FEBS Lett. 2004
Interaction	Activates Rv2026c	priti.priety	IEP		Coexpression(Functional linkage) J. Starck, G. Kllenius et al. Comparative proteome analysis of Mycobacterium tuberculosis grown under aerobic and anaerobic conditions. Microbiology (Reading, Engl.) 2004
Interaction	Inhibits Rv2021c	shahanup86	IEP		Co-expression (Functional linkage) SL. Kendall, F. Movahedzadeh et al. The Mycobacterium tuberculosis dosRS two-component system is induced by multiple stresses. Tuberculosis (Edinburgh, Scotland) 2004
Interaction	Regulatory Rv2003c	shahanup86	IEP		coexpression(Functional Linkage) authors,J. Bacon,BW. James,L. Wernisch,A. Williams,KA. Morley,GJ. Hatch,JA. Mangan,J. Hinds,NG. Stoker,PD. Butcher,PD. Marsh The influence of reduced oxygen availability on pathogenicity and gene expression in Mycobacterium tuberculosis. Tuberculosis (Edinb) 2004
Interaction	Regulatory Rv2007c	akankshajain.21	IEP		co-expression(Functional linkage) A. Kumar,JC. Toledo,RP. Patel,JR. Lancaster,AJ. Steyn Mycobacterium tuberculosis DosS is a redox sensor and DosT is a hypoxia sensor. Proc. Natl. Acad. Sci. U.S.A. 2007
Interaction	Regulatory Rv2007c	prabhakarsmail	IEP		co-expression(Functional linkage) A. Kumar,JC. Toledo,RP. Patel,JR. Lancaster,AJ. Steyn Mycobacterium tuberculosis DosS is a redox sensor and DosT is a hypoxia sensor. Proc. Natl. Acad. Sci. U.S.A. 2007
Interaction	Regulatory Rv1996	priyadarshinipriyanka2001	IEP		Co-expression (Functional linkage) MA. Florczyk, LA. McCue et al. A family of acr-coregulated Mycobacterium tuberculosis genes shares a common DNA motif and requires Rv3133c (dosR or devR) for expression. Infect. Immun. 2003
Interaction	Regulatory Rv1996	priyadarshinipriyanka2001	IEP		Co-expression (Functional linkage) authors,SM. Hingley-Wilson,KE. Lougheed,K. Ferguson,S. Leiva,HD. Williams Individual Mycobacterium tuberculosis universal stress protein homologues are dispensable in vitro. Tuberculosis (Edinb) 2010
Interaction	Regulatory Rv1706c	shahanup86	IEP		Co-expression (Functional linkage) SL. Kendall, F. Movahedzadeh et al. The Mycobacterium tuberculosis dosRS two-component system is induced by multiple stresses. Tuberculosis (Edinburgh, Scotland) 2004
Interaction	Regulatory Rv1706c	shahanup86	IEP		Co-expression (Functional linkage) authors,PB. Disler,SR. Lynch,JD. Torrance,MH. Sayers,TH. Bothwell,RW. Charlton The mechanism of the inhibition of iron absorption by tea. S Afr J Med Sci 1975
Interaction	Regulatory Rv1706c	shahanup86	IEP		Co-expression (Functional linkage) authors,PH. Chow,DK. Chan The cardiac cycle and the effects of neurohumors on myocardial contractility in the Asiatic eel Anguilla japonica, Timm. & Schle. Comp. Biochem. Physiol. C, Comp. Pharmacol. 1975
Interaction	Regulatory Rv1706c	shahanup86	IEP		Co-expression (Functional linkage) S. Tundup, Y. Akhter et al. Clusters of PE and PPE genes of Mycobacterium tuberculosis are organized in operons: evidence that PE Rv2431c is co-transcribed with PPE Rv2430c and their gene products interact with each other. FEBS Lett. 2006
Interaction	Regulatory Rv0830	bhupender.srcp	IEP		Co-expression (Functional linkage) SL. Kendall, F. Movahedzadeh et al. The Mycobacterium tuberculosis dosRS two-component system is induced by multiple stresses. Tuberculosis (Edinburgh, Scotland) 2004
Interaction	Regulatory Rv0830	bhupender.srcp	IEP		Co-expression (Functional linkage) SL. Kendall, F. Movahedzadeh et al. The Mycobacterium tuberculosis dosRS two-component system is induced by multiple stresses. Tuberculosis (Edinburgh, Scotland) 2004
Interaction	Regulatory Rv0796	kandarpbioinfo	IEP		Coexpression SL. Kendall, F. Movahedzadeh et al. The Mycobacterium tuberculosis dosRS two-component system is induced by multiple stresses. Tuberculosis (Edinburgh, Scotland) 2004
Interaction	Regulatory Rv0757	singhpankaj2116	IEP		Co-expression (Functional linkage) ML. Chesne-Seck, N. Barilone et al. A point mutation in the two-component regulator PhoP-PhoR accounts for the absence of polyketide-derived acyltrehaloses but not that of phthiocerol dimycocerosates in Mycobacterium tuberculosis H37Ra. J. Bacteriol. 2008
Interaction	Regulatory Rv0757	singhpankaj2116	IEP		Co-expression (Functional linkage) authors,A. Sola-Landa,RS. Moura,JF. Martn The two-component PhoR-PhoP system controls both primary metabolism and secondary metabolite biosynthesis in Streptomyces lividans. Proc. Natl. Acad. Sci. U.S.A. 2003
Interaction	Regulatory Rv0757	singhpankaj2116	IEP		Co-expression (Functional linkage) J. Gonzalo Asensio, C. Maia et al. The virulence-associated two-component PhoP-PhoR system controls the biosynthesis of polyketide-derived lipids in Mycobacterium tuberculosis. J. Biol. Chem. 2006
Interaction	Regulatory Rv0757	singhpankaj2116	IEP		Co-expression (Functional linkage) J. Gonzalo-Asensio, CY. Soto et al. The Mycobacterium tuberculosis phoPR operon is positively autoregulated in the virulent strain H37Rv. J. Bacteriol. 2008
Interaction	Regulatory Rv0757	singhpankaj2116	IEP		Co-expression (Functional linkage) A. Sinha, S. Gupta et al. PhoP-PhoP interaction at adjacent PhoP binding sites is influenced by protein phosphorylation. J. Bacteriol. 2008
Interaction	Regulatory Rv0757	singhpankaj2116	IEP		Co-expression (Functional linkage) J. Gonzalo Asensio, C. Maia et al. The virulence-associated two-component PhoP-PhoR system controls the biosynthesis of polyketide-derived lipids in Mycobacterium tuberculosis. J. Biol. Chem. 2006
Interaction	Regulatory Rv0757	singhpankaj2116	IEP		Co-expression (Functional linkage) M. Ryndak, S. Wang et al. PhoP, a key player in Mycobacterium tuberculosis virulence. Trends Microbiol. 2008
Interaction	Regulatory Rv0757	singhpankaj2116	IEP		Co-expression (Functional linkage) JA. Asensio, A. Arbus et al. Live tuberculosis vaccines based on phoP mutants: a step towards clinical trials. Expert opinion on biological therapy 2008
Interaction	Regulatory Rv0757	singhpankaj2116	IEP		Co-expression (Functional linkage) SB. Walters, E. Dubnau et al. The Mycobacterium tuberculosis PhoPR two-component system regulates genes essential for virulence and complex lipid biosynthesis. Mol. Microbiol. 2006
Interaction	Regulatory Rv0757	singhpankaj2116	IEP		Co-expression (Functional linkage) J. Gonzalo-Asensio, S. Mostowy et al. PhoP: a missing piece in the intricate puzzle of Mycobacterium tuberculosis virulence. PLoS ONE 2008
Interaction	Regulatory Rv0570	sourish10	IDA		PCR authors,J. Nurbo,AK. Roos,D. Muthas,E. Wahlstrm,DJ. Ericsson,T. Lundstedt,T. Unge,A. Karln Design, synthesis and evaluation of peptide inhibitors of Mycobacterium tuberculosis ribonucleotide reductase. J. Pept. Sci. 2007
Interaction	Regulatory Rv0570	ahal4789	IDA		PCR SS. Dawes, DF. Warner et al. Ribonucleotide reduction in Mycobacterium tuberculosis: function and expression of genes encoding class Ib and class II ribonucleotide reductases. Infect. Immun. 2003
Interaction	Regulatory Rv0570	ahal4789	IDA		PCR authors,J. Nurbo,AK. Roos,D. Muthas,E. Wahlstrm,DJ. Ericsson,T. Lundstedt,T. Unge,A. Karln Design, synthesis and evaluation of peptide inhibitors of Mycobacterium tuberculosis ribonucleotide reductase. J. Pept. Sci. 2007
Interaction	Regulatory Rv0570	sourish10	IDA		PCR SS. Dawes, DF. Warner et al. Ribonucleotide reduction in Mycobacterium tuberculosis: function and expression of genes encoding class Ib and class II ribonucleotide reductases. Infect. Immun. 2003
Interaction	Regulatory Rv0256c	shahanup86	IEP		Co-expression (Functional linkage) SL. Kendall, F. Movahedzadeh et al. The Mycobacterium tuberculosis dosRS two-component system is induced by multiple stresses. Tuberculosis (Edinburgh, Scotland) 2004
Interaction	Regulatory Rv0080	shahanup86	IEP		Co-expression (Functional linkage)
Interaction	Regulatory Rv0081	harsharohiratruefriend	TAS		GF. Black,BA. Thiel,MO. Ota,SK. Parida,R. Adegbola,WH. Boom,HM. Dockrell,KL. Franken,AH. Friggen,PC. Hill,MR. Klein,MK. Lalor,H. Mayanja,G. Schoolnik,K. Stanley,K. Weldingh,SH. Kaufmann,G. Walzl,TH. Ottenhoff,null. null Immunogenicity of novel DosR regulon-encoded candidate antigens of Mycobacterium tuberculosis in three high-burden populations in Africa. Clin. Vaccine Immunol. 2009
Citation	Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. M. Guo, H. Feng et al. Genome Res. 2009	yamir.moreno	IDA	19228590	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. .
Interaction	Regulates Rv2031c	yamir.moreno	IDA		One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv3833	yamir.moreno	IDA		One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv3692	yamir.moreno	IDA		One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Citation	Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. M. Guo, H. Feng et al. Genome Res. 2009	yamir.moreno	IDA	19228590	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. .
Interaction	Regulates Rv3505	yamir.moreno	IDA		One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Citation	Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. M. Guo, H. Feng et al. Genome Res. 2009	yamir.moreno	IDA	19228590	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. .
Interaction	Regulates Rv3132c	yamir.moreno	IDA		One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Citation	Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. M. Guo, H. Feng et al. Genome Res. 2009	yamir.moreno	IDA	19228590	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. .
Interaction	Regulates Rv3133c	yamir.moreno	IDA		One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv3133c	yamir.moreno	IDA		One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Citation	Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. M. Guo, H. Feng et al. Genome Res. 2009	yamir.moreno	IDA	19228590	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. .
Interaction	Regulates Rv3134c	yamir.moreno	IDA		One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Citation	Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. M. Guo, H. Feng et al. Genome Res. 2009	yamir.moreno	IDA	19228590	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. .
Interaction	Regulates Rv3504	yamir.moreno	IDA		One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Citation	Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. M. Guo, H. Feng et al. Genome Res. 2009	yamir.moreno	IDA	19228590	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. .
Interaction	Regulates Rv0353	yamir.moreno	IDA		One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Citation	Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. M. Guo, H. Feng et al. Genome Res. 2009	yamir.moreno	IDA	19228590	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. .
Interaction	Regulates Rv0467	yamir.moreno	IDA		One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Citation	Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. M. Guo, H. Feng et al. Genome Res. 2009	yamir.moreno	IDA	19228590	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. .
Interaction	Regulates Rv0468	yamir.moreno	IDA		One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Citation	Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. M. Guo, H. Feng et al. Genome Res. 2009	yamir.moreno	IDA	19228590	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. .
Interaction	Regulates Rv2590	yamir.moreno	IDA		One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Citation	Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. M. Guo, H. Feng et al. Genome Res. 2009	yamir.moreno	IDA	19228590	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. .
Interaction	Regulates Rv0350	yamir.moreno	IDA		One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Citation	Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. M. Guo, H. Feng et al. Genome Res. 2009	yamir.moreno	IDA	19228590	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. .
Interaction	Regulates Rv0351	yamir.moreno	IDA		One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Citation	Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. M. Guo, H. Feng et al. Genome Res. 2009	yamir.moreno	IDA	19228590	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. .
Interaction	Regulates Rv0352	yamir.moreno	IDA		One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv2669	yamir.moreno	IDA		One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv2017	yamir.moreno	IDA		One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv0491	yamir.moreno	IDA		One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv0757	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. J. Gonzalo Asensio, C. Maia et al. The virulence-associated two-component PhoP-PhoR system controls the biosynthesis of polyketide-derived lipids in Mycobacterium tuberculosis. J. Biol. Chem. 2006
Citation	The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008	yamir.moreno	TAS	18985025	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
Interaction	Regulates Rv3131	yamir.moreno	TAS		Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Citation	The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008	yamir.moreno	TAS	18985025	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
Interaction	Regulates Rv3134c	yamir.moreno	TAS		Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Citation	The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008	yamir.moreno	TAS	18985025	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
Interaction	Regulates Rv2006	yamir.moreno	TAS		Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv2626c	yamir.moreno	TAS		Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Citation	The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008	yamir.moreno	TAS	18985025	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
Interaction	Regulates Rv2627c	yamir.moreno	TAS		Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Citation	The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008	yamir.moreno	TAS	18985025	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
Interaction	Regulates Rv2628	yamir.moreno	TAS		Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Citation	The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008	yamir.moreno	TAS	18985025	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
Interaction	Regulates Rv3127	yamir.moreno	TAS		Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Citation	The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008	yamir.moreno	TAS	18985025	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
Interaction	Regulates Rv3130c	yamir.moreno	TAS		Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Citation	The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008	yamir.moreno	TAS	18985025	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
Interaction	Regulates Rv2006	yamir.moreno	TAS		Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Citation	The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008	yamir.moreno	TAS	18985025	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
Interaction	Regulates Rv2007c	yamir.moreno	TAS		Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Citation	The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008	yamir.moreno	TAS	18985025	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
Interaction	Regulates Rv2031c	yamir.moreno	TAS		Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Citation	The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008	yamir.moreno	TAS	18985025	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
Interaction	Regulates Rv2032	yamir.moreno	TAS		Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Citation	The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008	yamir.moreno	TAS	18985025	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
Citation	The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008	yamir.moreno	TAS	18985025	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
Interaction	Regulates Rv1738	yamir.moreno	TAS		Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Citation	The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008	yamir.moreno	TAS	18985025	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
Interaction	Regulates Rv1813c	yamir.moreno	TAS		Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Citation	The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008	yamir.moreno	TAS	18985025	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
Interaction	Regulates Rv1996	yamir.moreno	TAS		Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Citation	The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008	yamir.moreno	TAS	18985025	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
Interaction	Regulates Rv2005c	yamir.moreno	TAS		Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv0571c	yamir.moreno	TAS		Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Citation	The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008	yamir.moreno	TAS	18985025	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
Interaction	Regulates Rv0574c	yamir.moreno	TAS		Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Citation	The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008	yamir.moreno	TAS	18985025	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
Interaction	Regulates Rv1733c	yamir.moreno	TAS		Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Citation	The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008	yamir.moreno	TAS	18985025	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
Interaction	Regulates Rv1734c	yamir.moreno	TAS		Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Citation	The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008	yamir.moreno	TAS	18985025	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
Interaction	Regulates Rv1737c	yamir.moreno	TAS		Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Citation	The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008	yamir.moreno	TAS	18985025	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
Interaction	Regulates Rv0079	yamir.moreno	TAS		Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Citation	The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008	yamir.moreno	TAS	18985025	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
Citation	Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. HD. Park, KM. Guinn et al. Mol. Microbiol. 2003	yamir.moreno	IEP	12694625	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
Interaction	Regulates Rv3126c	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. HD. Park, KM. Guinn et al. Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. Mol. Microbiol. 2003
Citation	Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. HD. Park, KM. Guinn et al. Mol. Microbiol. 2003	yamir.moreno	IEP	12694625	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
Interaction	Regulates Rv3128c	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. HD. Park, KM. Guinn et al. Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. Mol. Microbiol. 2003
Interaction	Regulates Rv3129	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. HD. Park, KM. Guinn et al. Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. Mol. Microbiol. 2003
Citation	Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. HD. Park, KM. Guinn et al. Mol. Microbiol. 2003	yamir.moreno	IEP	12694625	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
Interaction	Regulates Rv3132c	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. HD. Park, KM. Guinn et al. Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. Mol. Microbiol. 2003
Citation	Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. HD. Park, KM. Guinn et al. Mol. Microbiol. 2003	yamir.moreno	IEP	12694625	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
Interaction	Regulates Rv3133c	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. HD. Park, KM. Guinn et al. Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. Mol. Microbiol. 2003
Interaction	RegulatedBy Rv3133c	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. HD. Park, KM. Guinn et al. Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. Mol. Microbiol. 2003
Citation	Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. HD. Park, KM. Guinn et al. Mol. Microbiol. 2003	yamir.moreno	IEP	12694625	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
Interaction	Regulates Rv3841	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. HD. Park, KM. Guinn et al. Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. Mol. Microbiol. 2003
Citation	Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. HD. Park, KM. Guinn et al. Mol. Microbiol. 2003	yamir.moreno	IEP	12694625	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
Interaction	Regulates Rv2630	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. HD. Park, KM. Guinn et al. Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. Mol. Microbiol. 2003
Citation	Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. HD. Park, KM. Guinn et al. Mol. Microbiol. 2003	yamir.moreno	IEP	12694625	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
Interaction	Regulates Rv2631	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. HD. Park, KM. Guinn et al. Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. Mol. Microbiol. 2003
Citation	Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. HD. Park, KM. Guinn et al. Mol. Microbiol. 2003	yamir.moreno	IEP	12694625	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
Interaction	Regulates Rv2830c	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. HD. Park, KM. Guinn et al. Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. Mol. Microbiol. 2003
Citation	Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. HD. Park, KM. Guinn et al. Mol. Microbiol. 2003	yamir.moreno	IEP	12694625	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
Citation	Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. HD. Park, KM. Guinn et al. Mol. Microbiol. 2003	yamir.moreno	IEP	12694625	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
Interaction	Regulates Rv2623	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. HD. Park, KM. Guinn et al. Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. Mol. Microbiol. 2003
Citation	Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. HD. Park, KM. Guinn et al. Mol. Microbiol. 2003	yamir.moreno	IEP	12694625	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
Interaction	Regulates Rv2624c	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. HD. Park, KM. Guinn et al. Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. Mol. Microbiol. 2003
Citation	Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. HD. Park, KM. Guinn et al. Mol. Microbiol. 2003	yamir.moreno	IEP	12694625	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
Interaction	Regulates Rv2625c	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. HD. Park, KM. Guinn et al. Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. Mol. Microbiol. 2003
Citation	Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. HD. Park, KM. Guinn et al. Mol. Microbiol. 2003	yamir.moreno	IEP	12694625	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
Interaction	Regulates Rv2629	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. HD. Park, KM. Guinn et al. Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. Mol. Microbiol. 2003
Interaction	Regulates Rv2004c	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. HD. Park, KM. Guinn et al. Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. Mol. Microbiol. 2003
Citation	Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. HD. Park, KM. Guinn et al. Mol. Microbiol. 2003	yamir.moreno	IEP	12694625	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
Interaction	Regulates Rv2028c	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. HD. Park, KM. Guinn et al. Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. Mol. Microbiol. 2003
Citation	Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. HD. Park, KM. Guinn et al. Mol. Microbiol. 2003	yamir.moreno	IEP	12694625	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
Interaction	Regulates Rv2029c	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. HD. Park, KM. Guinn et al. Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. Mol. Microbiol. 2003
Citation	Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. HD. Park, KM. Guinn et al. Mol. Microbiol. 2003	yamir.moreno	IEP	12694625	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
Interaction	Regulates Rv2030c	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. HD. Park, KM. Guinn et al. Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. Mol. Microbiol. 2003
Citation	Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. HD. Park, KM. Guinn et al. Mol. Microbiol. 2003	yamir.moreno	IEP	12694625	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
Interaction	Regulates Rv1812c	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. HD. Park, KM. Guinn et al. Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. Mol. Microbiol. 2003
Citation	Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. HD. Park, KM. Guinn et al. Mol. Microbiol. 2003	yamir.moreno	IEP	12694625	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
Interaction	Regulates Rv1997	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. HD. Park, KM. Guinn et al. Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. Mol. Microbiol. 2003
Citation	Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. HD. Park, KM. Guinn et al. Mol. Microbiol. 2003	yamir.moreno	IEP	12694625	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
Interaction	Regulates Rv2003c	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. HD. Park, KM. Guinn et al. Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. Mol. Microbiol. 2003
Citation	Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. HD. Park, KM. Guinn et al. Mol. Microbiol. 2003	yamir.moreno	IEP	12694625	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
Citation	Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. HD. Park, KM. Guinn et al. Mol. Microbiol. 2003	yamir.moreno	IEP	12694625	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
Interaction	Regulates Rv0569	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. HD. Park, KM. Guinn et al. Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. Mol. Microbiol. 2003
Citation	Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. HD. Park, KM. Guinn et al. Mol. Microbiol. 2003	yamir.moreno	IEP	12694625	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
Interaction	Regulates Rv0570	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. HD. Park, KM. Guinn et al. Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. Mol. Microbiol. 2003
Citation	Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. HD. Park, KM. Guinn et al. Mol. Microbiol. 2003	yamir.moreno	IEP	12694625	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
Interaction	Regulates Rv0572c	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. HD. Park, KM. Guinn et al. Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. Mol. Microbiol. 2003
Citation	Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. HD. Park, KM. Guinn et al. Mol. Microbiol. 2003	yamir.moreno	IEP	12694625	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
Interaction	Regulates Rv1736c	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. HD. Park, KM. Guinn et al. Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. Mol. Microbiol. 2003
Interaction	Regulates Rv0080	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. HD. Park, KM. Guinn et al. Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. Mol. Microbiol. 2003
Citation	Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. HD. Park, KM. Guinn et al. Mol. Microbiol. 2003	yamir.moreno	IEP	12694625	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
Interaction	Regulates Rv0081	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. HD. Park, KM. Guinn et al. Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. Mol. Microbiol. 2003
Citation	Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. HD. Park, KM. Guinn et al. Mol. Microbiol. 2003	yamir.moreno	IEP	12694625	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
Interaction	Regulates Rv0082	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. HD. Park, KM. Guinn et al. Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. Mol. Microbiol. 2003
Citation	Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. HD. Park, KM. Guinn et al. Mol. Microbiol. 2003	yamir.moreno	IEP	12694625	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
Interaction	Regulates Rv0083	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. HD. Park, KM. Guinn et al. Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. Mol. Microbiol. 2003
Citation	Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. HD. Park, KM. Guinn et al. Mol. Microbiol. 2003	yamir.moreno	IEP	12694625	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
Interaction	Regulates Rv0079	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. HD. Park, KM. Guinn et al. Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. Mol. Microbiol. 2003
Citation	Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. HD. Park, KM. Guinn et al. Mol. Microbiol. 2003	yamir.moreno	IEP	12694625	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..

Property

Value

Creator

Evidence

PMID

Comment

Interaction

Regulatory Rv3690

priyadarshinipriyanka2001

IEP

Co-expression (Functional linkage)
SL. Kendall, F. Movahedzadeh et al. The Mycobacterium tuberculosis dosRS two-component system is induced by multiple stresses. Tuberculosis (Edinburgh, Scotland) 2004

Interaction

Regulatory Rv3690

aparna.vchalam

IEP

Interaction

Regulatory Rv3143

shahanup86

IEP

Interaction

PhysicalInteraction Rv3134c

kaveri.verma

IPI

Affinity purification (Physical interaction)
G. Bagchi, null. Mayuri et al. Hypoxia-responsive expression of Mycobacterium tuberculosis Rv3134c and devR promoters in Mycobacterium smegmatis. Microbiology (Reading, Engl.) 2003

Interaction

PhysicalInteraction Rv3134c

kaveri.verma

IPI

Affinity purification (Physical interaction)
null. Mayuri, G. Bagchi et al. Molecular analysis of the dormancy response in Mycobacterium smegmatis: expression analysis of genes encoding the DevR-DevS two-component system, Rv3134c and chaperone alpha-crystallin homologues. FEMS Microbiol. Lett. 2002

Interaction

PhysicalInteraction Rv3134c

kaveri.verma

IPI

Affinity purification (Physical interaction)
PJ. Converse, PC. Karakousis et al. The role of the dosR/dosS two-component regulatory system in Mycobacterium tuberculosis virulence in three animal models. Infect. Immun. 2008

Interaction

PhysicalInteraction Rv3134c

kaveri.verma

IPI

Affinity purification (Physical interaction)
JG. Rodriguez, CS. Burbano et al. Rv3134c/devR/devS operon of Mycobacterium bovis BCG is differentially transcribed under in vitro stress conditions. Tuberculosis (Edinburgh, Scotland) 2008

Citation

Mycobacterium tuberculosis DosS is a redox sensor and DosT is a hypoxia sensor. A. Kumar,JC. Toledo,RP. Patel,JR. Lancaster,AJ. Steyn Proc. Natl. Acad. Sci. U.S.A. 2007

jhum4u2006

IEP

17609369

Co-occurrence (Functional linkage)

Interaction

Regulatory Rv3132c

jhum4u2006

IEP

Co-occurrence (Functional linkage)
A. Kumar,JC. Toledo,RP. Patel,JR. Lancaster,AJ. Steyn Mycobacterium tuberculosis DosS is a redox sensor and DosT is a hypoxia sensor. Proc. Natl. Acad. Sci. U.S.A. 2007

Interaction

PhysicalInteraction Rv3134c

kaveri.verma

IPI

Affinity purification (Physical interaction)
S. Chauhan & JS. Tyagi Cooperative binding of phosphorylated DevR to upstream sites is necessary and sufficient for activation of the Rv3134c-devRS operon in Mycobacterium tuberculosis: implication in the induction of DevR target genes. J. Bacteriol. 2008

Citation

Comprehensive proteomic profiling of the membrane constituents of a Mycobacterium tuberculosis strain. authors,S. Gu,J. Chen,KM. Dobos,EM. Bradbury,JT. Belisle,X. Chen Mol. Cell Proteomics 2003

jhum4u2006

IEP

14532352

Co-occurrence (Functional linkage)

Interaction

Regulatory Rv3132c

jhum4u2006

IEP

Co-occurrence (Functional linkage)
authors,S. Gu,J. Chen,KM. Dobos,EM. Bradbury,JT. Belisle,X. Chen Comprehensive proteomic profiling of the membrane constituents of a Mycobacterium tuberculosis strain. Mol. Cell Proteomics 2003

Citation

Two sensor kinases contribute to the hypoxic response of Mycobacterium tuberculosis. DM. Roberts, RP. Liao et al. J. Biol. Chem. 2004

jhum4u2006

IEP

15033981

Co-occurrence (Functional linkage)

Interaction

Regulatory Rv3132c

jhum4u2006

IEP

Co-occurrence (Functional linkage)
DM. Roberts, RP. Liao et al. Two sensor kinases contribute to the hypoxic response of Mycobacterium tuberculosis. J. Biol. Chem. 2004

Citation

DevR-DevS is a bona fide two-component system of Mycobacterium tuberculosis that is hypoxia-responsive in the absence of the DNA-binding domain of DevR. DK. Saini, V. Malhotra et al. Microbiology (Reading, Engl.) 2004

jhum4u2006

IEP

15073296

Co-occurrence (Functional linkage)

Interaction

Regulatory Rv3132c

jhum4u2006

IEP

Co-occurrence (Functional linkage)
DK. Saini, V. Malhotra et al. DevR-DevS is a bona fide two-component system of Mycobacterium tuberculosis that is hypoxia-responsive in the absence of the DNA-binding domain of DevR. Microbiology (Reading, Engl.) 2004

Citation

A GAF domain in the hypoxia/NO-inducible Mycobacterium tuberculosis DosS protein binds haem. S. Sardiwal,SL. Kendall,F. Movahedzadeh,SC. Rison,NG. Stoker,S. Djordjevic J. Mol. Biol. 2005

jhum4u2006

IEP

16213520

Co-occurrence (Functional linkage)

Interaction

Regulatory Rv3132c

jhum4u2006

IEP

Co-occurrence (Functional linkage)
S. Sardiwal,SL. Kendall,F. Movahedzadeh,SC. Rison,NG. Stoker,S. Djordjevic A GAF domain in the hypoxia/NO-inducible Mycobacterium tuberculosis DosS protein binds haem. J. Mol. Biol. 2005

Citation

DosT and DevS are oxygen-switched kinases in Mycobacterium tuberculosis. EH. Sousa, JR. Tuckerman et al. Protein Sci. 2007

jhum4u2006

IEP

17600145

Co-occurrence (Functional linkage)

Interaction

Regulatory Rv3132c

jhum4u2006

IEP

Co-occurrence (Functional linkage)
EH. Sousa, JR. Tuckerman et al. DosT and DevS are oxygen-switched kinases in Mycobacterium tuberculosis. Protein Sci. 2007

Interaction

Regulatory Rv3132c

jhum4u2006

IEP

Co-occurrence (Functional linkage)
authors,JC. Betts,PT. Lukey,LC. Robb,RA. McAdam,K. Duncan Evaluation of a nutrient starvation model of Mycobacterium tuberculosis persistence by gene and protein expression profiling. Mol. Microbiol. 2002

Citation

Molecular analysis of the dormancy response in Mycobacterium smegmatis: expression analysis of genes encoding the DevR-DevS two-component system, Rv3134c and chaperone alpha-crystallin homologues. null. Mayuri, G. Bagchi et al. FEMS Microbiol. Lett. 2002

jhum4u2006

IEP

12076818

Co-occurrence (Functional linkage)

Interaction

Regulatory Rv3132c

jhum4u2006

IEP

Co-occurrence (Functional linkage)
null. Mayuri, G. Bagchi et al. Molecular analysis of the dormancy response in Mycobacterium smegmatis: expression analysis of genes encoding the DevR-DevS two-component system, Rv3134c and chaperone alpha-crystallin homologues. FEMS Microbiol. Lett. 2002

Citation

Cloning, overexpression, purification, and matrix-assisted refolding of DevS (Rv 3132c) histidine protein kinase of Mycobacterium tuberculosis. DK. Saini, N. Pant et al. Protein Expr. Purif. 2002

jhum4u2006

IEP

12071717

Co-occurrence (Functional linkage)

Interaction

Regulatory Rv3132c

jhum4u2006

IEP

Co-occurrence (Functional linkage)
DK. Saini, N. Pant et al. Cloning, overexpression, purification, and matrix-assisted refolding of DevS (Rv 3132c) histidine protein kinase of Mycobacterium tuberculosis. Protein Expr. Purif. 2002

Citation

Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. HD. Park, KM. Guinn et al. Mol. Microbiol. 2003

jhum4u2006

IEP

12694625

Co-occurrence (Functional linkage)

Interaction

Regulatory Rv3132c

jhum4u2006

IEP

Co-occurrence (Functional linkage)
HD. Park, KM. Guinn et al. Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. Mol. Microbiol. 2003

Citation

Inhibition of respiration by nitric oxide induces a Mycobacterium tuberculosis dormancy program. MI. Voskuil, D. Schnappinger et al. J. Exp. Med. 2003

jhum4u2006

IEP

12953092

Co-occurrence (Functional linkage)

Interaction

Regulatory Rv3132c

jhum4u2006

IEP

Co-occurrence (Functional linkage)
MI. Voskuil, D. Schnappinger et al. Inhibition of respiration by nitric oxide induces a Mycobacterium tuberculosis dormancy program. J. Exp. Med. 2003

Interaction

Regulatory Rv3132c

hibeeluck

IEP

Citation

Structural insight into the heme-based redox sensing by DosS from Mycobacterium tuberculosis. HY. Cho,HJ. Cho,YM. Kim,JI. Oh,BS. Kang J. Biol. Chem. 2009

jhum4u2006

IEP

19276084

Co-occurrence (Functional linkage)

Interaction

Regulatory Rv3132c

jhum4u2006

IEP

Co-occurrence (Functional linkage)
HY. Cho,HJ. Cho,YM. Kim,JI. Oh,BS. Kang Structural insight into the heme-based redox sensing by DosS from Mycobacterium tuberculosis. J. Biol. Chem. 2009

Citation

The role of the dosR/dosS two-component regulatory system in Mycobacterium tuberculosis virulence in three animal models. PJ. Converse, PC. Karakousis et al. Infect. Immun. 2008

jhum4u2006

IEP

19103767

Co-occurrence (Functional linkage)

Interaction

Regulatory Rv3132c

jhum4u2006

IEP

Co-occurrence (Functional linkage)
PJ. Converse, PC. Karakousis et al. The role of the dosR/dosS two-component regulatory system in Mycobacterium tuberculosis virulence in three animal models. Infect. Immun. 2008

Citation

Regulation of the Mycobacterium tuberculosis hypoxic response gene encoding alpha -crystallin. DR. Sherman, M. Voskuil et al. Proc. Natl. Acad. Sci. U.S.A. 2001

jhum4u2006

IEP

11416222

Co-occurrence (Functional linkage)

Interaction

Regulatory Rv3132c

jhum4u2006

IEP

Co-occurrence (Functional linkage)
DR. Sherman, M. Voskuil et al. Regulation of the Mycobacterium tuberculosis hypoxic response gene encoding alpha -crystallin. Proc. Natl. Acad. Sci. U.S.A. 2001

Citation

Characterization of a two-component system, devR-devS, of Mycobacterium tuberculosis. N. Dasgupta, V. Kapur et al. Tuber. Lung Dis. 2000

jhum4u2006

IEP

10970762

Co-occurrence (Functional linkage)

Interaction

Regulatory Rv3132c

jhum4u2006

IEP

Co-occurrence (Functional linkage)
N. Dasgupta, V. Kapur et al. Characterization of a two-component system, devR-devS, of Mycobacterium tuberculosis. Tuber. Lung Dis. 2000

Citation

Evaluation of a nutrient starvation model of Mycobacterium tuberculosis persistence by gene and protein expression profiling. authors,JC. Betts,PT. Lukey,LC. Robb,RA. McAdam,K. Duncan Mol. Microbiol. 2002

jhum4u2006

IEP

11929527

Co-occurrence (Functional linkage)

Interaction

Regulatory Rv3132c

hibeeluck

IEP

Citation

Two sensor kinases contribute to the hypoxic response of Mycobacterium tuberculosis. DM. Roberts, RP. Liao et al. J. Biol. Chem. 2004

hibeeluck

IEP

15033981

Co-occurrence (Functional linkage)

Interaction

Regulatory Rv3132c

hibeeluck

IEP

Co-occurrence (Functional linkage)
DM. Roberts, RP. Liao et al. Two sensor kinases contribute to the hypoxic response of Mycobacterium tuberculosis. J. Biol. Chem. 2004

Citation

hibeeluck

IEP

15073296

Co-occurrence (Functional linkage)

Interaction

Regulatory Rv3132c

hibeeluck

IEP

Citation

A GAF domain in the hypoxia/NO-inducible Mycobacterium tuberculosis DosS protein binds haem. S. Sardiwal,SL. Kendall,F. Movahedzadeh,SC. Rison,NG. Stoker,S. Djordjevic J. Mol. Biol. 2005

hibeeluck

IEP

16213520

Co-occurrence (Functional linkage)

Interaction

Regulatory Rv3132c

hibeeluck

IEP

Citation

DosT and DevS are oxygen-switched kinases in Mycobacterium tuberculosis. EH. Sousa, JR. Tuckerman et al. Protein Sci. 2007

hibeeluck

IEP

17600145

Co-occurrence (Functional linkage)

Interaction

Regulatory Rv3132c

hibeeluck

IEP

Co-occurrence (Functional linkage)
EH. Sousa, JR. Tuckerman et al. DosT and DevS are oxygen-switched kinases in Mycobacterium tuberculosis. Protein Sci. 2007

Citation

Mycobacterium tuberculosis DosS is a redox sensor and DosT is a hypoxia sensor. A. Kumar,JC. Toledo,RP. Patel,JR. Lancaster,AJ. Steyn Proc. Natl. Acad. Sci. U.S.A. 2007

hibeeluck

IEP

17609369

Co-occurrence (Functional linkage)

Citation

hibeeluck

IEP

12076818

Co-occurrence (Functional linkage)

Interaction

Regulatory Rv3132c

hibeeluck

IEP

Citation

Cloning, overexpression, purification, and matrix-assisted refolding of DevS (Rv 3132c) histidine protein kinase of Mycobacterium tuberculosis. DK. Saini, N. Pant et al. Protein Expr. Purif. 2002

hibeeluck

IEP

12071717

Co-occurrence (Functional linkage)

Interaction

Regulatory Rv3132c

hibeeluck

IEP

Citation

Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. HD. Park, KM. Guinn et al. Mol. Microbiol. 2003

hibeeluck

IEP

12694625

Co-occurrence (Functional linkage)

Interaction

Regulatory Rv3132c

hibeeluck

IEP

Co-occurrence (Functional linkage)
HD. Park, KM. Guinn et al. Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. Mol. Microbiol. 2003

Citation

Inhibition of respiration by nitric oxide induces a Mycobacterium tuberculosis dormancy program. MI. Voskuil, D. Schnappinger et al. J. Exp. Med. 2003

hibeeluck

IEP

12953092

Co-occurrence (Functional linkage)

Interaction

Regulatory Rv3132c

hibeeluck

IEP

Co-occurrence (Functional linkage)
MI. Voskuil, D. Schnappinger et al. Inhibition of respiration by nitric oxide induces a Mycobacterium tuberculosis dormancy program. J. Exp. Med. 2003

Citation

Comprehensive proteomic profiling of the membrane constituents of a Mycobacterium tuberculosis strain. authors,S. Gu,J. Chen,KM. Dobos,EM. Bradbury,JT. Belisle,X. Chen Mol. Cell Proteomics 2003

hibeeluck

IEP

14532352

Co-occurrence (Functional linkage)

Interaction

Regulatory Rv3132c

jhum4u2006

IEP

Affinity purification (Physical interaction)
A. Kumar,JC. Toledo,RP. Patel,JR. Lancaster,AJ. Steyn Mycobacterium tuberculosis DosS is a redox sensor and DosT is a hypoxia sensor. Proc. Natl. Acad. Sci. U.S.A. 2007

Citation

Structural insight into the heme-based redox sensing by DosS from Mycobacterium tuberculosis. HY. Cho,HJ. Cho,YM. Kim,JI. Oh,BS. Kang J. Biol. Chem. 2009

hibeeluck

IEP

19276084

Co-occurrence (Functional linkage)

Interaction

Regulatory Rv3132c

hibeeluck

IEP

Co-occurrence (Functional linkage)
HY. Cho,HJ. Cho,YM. Kim,JI. Oh,BS. Kang Structural insight into the heme-based redox sensing by DosS from Mycobacterium tuberculosis. J. Biol. Chem. 2009

Citation

The role of the dosR/dosS two-component regulatory system in Mycobacterium tuberculosis virulence in three animal models. PJ. Converse, PC. Karakousis et al. Infect. Immun. 2008

hibeeluck

IEP

19103767

Co-occurrence (Functional linkage)

Interaction

Regulatory Rv3132c

hibeeluck

IEP

Citation

Regulation of the Mycobacterium tuberculosis hypoxic response gene encoding alpha -crystallin. DR. Sherman, M. Voskuil et al. Proc. Natl. Acad. Sci. U.S.A. 2001

hibeeluck

IEP

11416222

Co-occurrence (Functional linkage)

Interaction

Regulatory Rv3132c

hibeeluck

IEP

Co-occurrence (Functional linkage)
DR. Sherman, M. Voskuil et al. Regulation of the Mycobacterium tuberculosis hypoxic response gene encoding alpha -crystallin. Proc. Natl. Acad. Sci. U.S.A. 2001

Citation

Characterization of a two-component system, devR-devS, of Mycobacterium tuberculosis. N. Dasgupta, V. Kapur et al. Tuber. Lung Dis. 2000

hibeeluck

IEP

10970762

Co-occurrence (Functional linkage)

Interaction

Regulatory Rv3132c

hibeeluck

IEP

Co-occurrence (Functional linkage)
N. Dasgupta, V. Kapur et al. Characterization of a two-component system, devR-devS, of Mycobacterium tuberculosis. Tuber. Lung Dis. 2000

Citation

hibeeluck

IEP

11929527

Co-occurrence (Functional linkage)

Interaction

Regulatory Rv3132c

hibeeluck

IEP

Interaction

Regulatory Rv3132c

jhum4u2006

IEP

Affinity purification (Physical interaction)
DM. Roberts, RP. Liao et al. Two sensor kinases contribute to the hypoxic response of Mycobacterium tuberculosis. J. Biol. Chem. 2004

Interaction

Regulatory Rv3132c

jhum4u2006

IEP

Affinity purification (Physical interaction)
DK. Saini, V. Malhotra et al. DevR-DevS is a bona fide two-component system of Mycobacterium tuberculosis that is hypoxia-responsive in the absence of the DNA-binding domain of DevR. Microbiology (Reading, Engl.) 2004

Interaction

Regulatory Rv3132c

jhum4u2006

IEP

Affinity purification (Physical interaction)
S. Sardiwal,SL. Kendall,F. Movahedzadeh,SC. Rison,NG. Stoker,S. Djordjevic A GAF domain in the hypoxia/NO-inducible Mycobacterium tuberculosis DosS protein binds haem. J. Mol. Biol. 2005

Interaction

Regulatory Rv3132c

jhum4u2006

IEP

Affinity purification (Physical interaction)
EH. Sousa, JR. Tuckerman et al. DosT and DevS are oxygen-switched kinases in Mycobacterium tuberculosis. Protein Sci. 2007

Interaction

Regulatory Rv3132c

jhum4u2006

IEP

Interaction

Regulatory Rv3132c

jhum4u2006

IEP

Affinity purification (Physical interaction)
DK. Saini, N. Pant et al. Cloning, overexpression, purification, and matrix-assisted refolding of DevS (Rv 3132c) histidine protein kinase of Mycobacterium tuberculosis. Protein Expr. Purif. 2002

Interaction

Regulatory Rv3132c

jhum4u2006

IEP

Affinity purification (Physical interaction)
HD. Park, KM. Guinn et al. Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. Mol. Microbiol. 2003

Interaction

Regulatory Rv3132c

jhum4u2006

IEP

Affinity purification (Physical interaction)
MI. Voskuil, D. Schnappinger et al. Inhibition of respiration by nitric oxide induces a Mycobacterium tuberculosis dormancy program. J. Exp. Med. 2003

Interaction

Regulatory Rv3132c

jhum4u2006

IEP

Affinity purification (Physical interaction)
authors,S. Gu,J. Chen,KM. Dobos,EM. Bradbury,JT. Belisle,X. Chen Comprehensive proteomic profiling of the membrane constituents of a Mycobacterium tuberculosis strain. Mol. Cell Proteomics 2003

Interaction

Regulatory Rv3132c

jhum4u2006

IEP

Affinity purification (Physical interaction)
HY. Cho,HJ. Cho,YM. Kim,JI. Oh,BS. Kang Structural insight into the heme-based redox sensing by DosS from Mycobacterium tuberculosis. J. Biol. Chem. 2009

Interaction

Regulatory Rv3132c

jhum4u2006

IEP

Interaction

Regulatory Rv3132c

jhum4u2006

IEP

Affinity purification (Physical interaction)
DR. Sherman, M. Voskuil et al. Regulation of the Mycobacterium tuberculosis hypoxic response gene encoding alpha -crystallin. Proc. Natl. Acad. Sci. U.S.A. 2001

Interaction

Regulatory Rv3132c

jhum4u2006

IEP

Affinity purification (Physical interaction)
N. Dasgupta, V. Kapur et al. Characterization of a two-component system, devR-devS, of Mycobacterium tuberculosis. Tuber. Lung Dis. 2000

Interaction

Regulatory Rv3132c

jhum4u2006

IEP

Affinity purification (Physical interaction)
authors,JC. Betts,PT. Lukey,LC. Robb,RA. McAdam,K. Duncan Evaluation of a nutrient starvation model of Mycobacterium tuberculosis persistence by gene and protein expression profiling. Mol. Microbiol. 2002

Interaction

Regulatory Rv3132c

hibeeluck

IEP

Interaction

Regulatory Rv3132c

hibeeluck

IEP

Interaction

Regulatory Rv3132c

hibeeluck

IEP

Affinity purification (Physical interaction)
EH. Sousa, JR. Tuckerman et al. DosT and DevS are oxygen-switched kinases in Mycobacterium tuberculosis. Protein Sci. 2007

Interaction

Regulatory Rv3132c

hibeeluck

IEP

Interaction

Regulatory Rv3132c

hibeeluck

IEP

Interaction

Regulatory Rv3132c

hibeeluck

IEP

Affinity purification (Physical interaction)
HD. Park, KM. Guinn et al. Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. Mol. Microbiol. 2003

Interaction

Regulatory Rv3132c

hibeeluck

IEP

Affinity purification (Physical interaction)
MI. Voskuil, D. Schnappinger et al. Inhibition of respiration by nitric oxide induces a Mycobacterium tuberculosis dormancy program. J. Exp. Med. 2003

Interaction

Regulatory Rv3132c

hibeeluck

IEP

Interaction

Regulatory Rv3132c

hibeeluck

IEP

Affinity purification (Physical interaction)
DM. Roberts, RP. Liao et al. Two sensor kinases contribute to the hypoxic response of Mycobacterium tuberculosis. J. Biol. Chem. 2004

Interaction

Regulatory Rv3132c

hibeeluck

IEP

Interaction

Regulatory Rv3132c

hibeeluck

IEP

Interaction

Regulatory Rv3132c

hibeeluck

IEP

Affinity purification (Physical interaction)
N. Dasgupta, V. Kapur et al. Characterization of a two-component system, devR-devS, of Mycobacterium tuberculosis. Tuber. Lung Dis. 2000

Interaction

Regulatory Rv3132c

hibeeluck

IEP

Interaction

Regulatory Rv3132c

hibeeluck

IEP

Interaction

Regulatory Rv3129

kaveri.verma

IEP

Co-expression (Functional linkage)
GF. Black,BA. Thiel,MO. Ota,SK. Parida,R. Adegbola,WH. Boom,HM. Dockrell,KL. Franken,AH. Friggen,PC. Hill,MR. Klein,MK. Lalor,H. Mayanja,G. Schoolnik,K. Stanley,K. Weldingh,SH. Kaufmann,G. Walzl,TH. Ottenhoff,null. null Immunogenicity of novel DosR regulon-encoded candidate antigens of Mycobacterium tuberculosis in three high-burden populations in Africa. Clin. Vaccine Immunol. 2009

Interaction

Regulatory Rv3130c

shahanup86

IEP

Co-expression (Functional linkage)
S. Chauhan,JS. Tyagi Powerful induction of divergent tgs1-Rv3131 genes in Mycobacterium tuberculosis is mediated by DevR interaction with a high-affinity site and an adjacent cryptic low-affinity site. J. Bacteriol. 2009

Interaction

Regulatory Rv3131

shahanup86

IDA

Affinity purification (Physical interaction)
S. Chauhan,JS. Tyagi Powerful induction of divergent tgs1-Rv3131 genes in Mycobacterium tuberculosis is mediated by DevR interaction with a high-affinity site and an adjacent cryptic low-affinity site. J. Bacteriol. 2009

Interaction

Regulatory Rv3132c

hibeeluck

IEP

Affinity purification (Physical interaction)
HY. Cho,HJ. Cho,YM. Kim,JI. Oh,BS. Kang Structural insight into the heme-based redox sensing by DosS from Mycobacterium tuberculosis. J. Biol. Chem. 2009

Interaction

Regulatory Rv3129

kaveri.verma

IEP

Co-expression (Functional linkage)
HD. Park, KM. Guinn et al. Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. Mol. Microbiol. 2003

Interaction

Transcription Rv2623

sourish10

IEP

Co-expression (Functional linkage)
MA. Florczyk, LA. McCue et al. A family of acr-coregulated Mycobacterium tuberculosis genes shares a common DNA motif and requires Rv3133c (dosR or devR) for expression. Infect. Immun. 2003

Interaction

Regulatory Rv2625c

shruti4rana

NAS

GF. Black,BA. Thiel,MO. Ota,SK. Parida,R. Adegbola,WH. Boom,HM. Dockrell,KL. Franken,AH. Friggen,PC. Hill,MR. Klein,MK. Lalor,H. Mayanja,G. Schoolnik,K. Stanley,K. Weldingh,SH. Kaufmann,G. Walzl,TH. Ottenhoff,null. null Immunogenicity of novel DosR regulon-encoded candidate antigens of Mycobacterium tuberculosis in three high-burden populations in Africa. Clin. Vaccine Immunol. 2009

Interaction

Regulatory Rv2627c

shruti4rana

NAS

MY. Lin,TB. Reddy,SM. Arend,AH. Friggen,KL. Franken,KE. van Meijgaarden,MJ. Verduyn,GK. Schoolnik,MR. Klein,TH. Ottenhoff Cross-reactive immunity to Mycobacterium tuberculosis DosR regulon-encoded antigens in individuals infected with environmental, nontuberculous mycobacteria. Infect. Immun. 2009

Interaction

Transcription Rv2623

sourish10

IEP

Co-expression (Functional linkage)
JE. Drumm, K. Mi et al. Mycobacterium tuberculosis universal stress protein Rv2623 regulates bacillary growth by ATP-Binding: requirement for establishing chronic persistent infection. PLoS Pathog. 2009

Interaction

Transcription Rv2623

sourish10

IEP

Co-expression (Functional linkage)
authors,M. Seki,I. Honda,I. Fujita,I. Yano,S. Yamamoto,A. Koyama Whole genome sequence analysis of Mycobacterium bovis bacillus Calmette-Gurin (BCG) Tokyo 172: a comparative study of BCG vaccine substrains. Vaccine 2009

Interaction

Regulatory Rv2590

hibeeluck

IPI

Yeast one Hybrid
J. Gonzalo-Asensio, S. Mostowy et al. PhoP: a missing piece in the intricate puzzle of Mycobacterium tuberculosis virulence. PLoS ONE 2008

Interaction

Regulatory Rv2590

hibeeluck

IPI

Yeast one Hybrid
authors,KG. Mawuenyega,CV. Forst,KM. Dobos,JT. Belisle,J. Chen,EM. Bradbury,AR. Bradbury,X. Chen Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling. Mol. Biol. Cell 2005

Interaction

Regulatory Rv2590

hibeeluck

IPI

Yeast one Hybrid
R. Manganelli, MI. Voskuil et al. The Mycobacterium tuberculosis ECF sigma factor sigmaE: role in global gene expression and survival in macrophages. Mol. Microbiol. 2001

Interaction

Regulatory Rv2590

hibeeluck

IPI

Yeast one Hybrid
M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009

Interaction

Regulatory Rv2255c

akankshajain.21

IEP

Co-expression (Functional Linkage)
SL. Kendall, F. Movahedzadeh et al. The Mycobacterium tuberculosis dosRS two-component system is induced by multiple stresses. Tuberculosis (Edinburgh, Scotland) 2004

Interaction

Activates Rv2028c

priti.priety

IEP

Coexpression(Functional linkage)
authors,IG. Alekseeva,GP. Lapina,ZD. Tulovskaia,VN. Izma-lova [Structure formation in interphase adsorption layers of lysozyme at liquid boundaries]. Biofizika null

Interaction

Signaling Rv2031c

priti.priety

IDA

affinity purification
M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009

Interaction

Signaling Rv2031c

priti.priety

IDA

affinity purification
A. Demissie, EM. Leyten et al. Recognition of stage-specific mycobacterial antigens differentiates between acute and latent infections with Mycobacterium tuberculosis. Clin. Vaccine Immunol. 2006

Interaction

ActivatedBy Rv2027c

priti.priety

IDA

Band Shift
DM. Roberts, RP. Liao et al. Two sensor kinases contribute to the hypoxic response of Mycobacterium tuberculosis. J. Biol. Chem. 2004

Interaction

Activates Rv2028c

priti.priety

IEP

Coexpression(Functional linkage)
J. Starck, G. Kllenius et al. Comparative proteome analysis of Mycobacterium tuberculosis grown under aerobic and anaerobic conditions. Microbiology (Reading, Engl.) 2004

Interaction

Activates Rv2028c

priti.priety

IEP

Coexpression(Functional linkage)
authors,BM. Altura Role of prostaglandins and histamine in reactive hyperemia: in-vivo studies on single mesenteric arterioles. Prostaglandins Med 1978

Interaction

Activates Rv2026c

priti.priety

IEP

Coexpression(Functional linkage)
authors,BM. Altura Role of prostaglandins and histamine in reactive hyperemia: in-vivo studies on single mesenteric arterioles. Prostaglandins Med 1978

Interaction

Activates Rv2026c

priti.priety

IEP

Coexpression(Functional linkage)
authors,IG. Alekseeva,GP. Lapina,ZD. Tulovskaia,VN. Izma-lova [Structure formation in interphase adsorption layers of lysozyme at liquid boundaries]. Biofizika null

Interaction

ActivatedBy Rv2027c

priti.priety

IDA

Band Shift
DK. Saini, V. Malhotra et al. Cross talk between DevS sensor kinase homologue, Rv2027c, and DevR response regulator of Mycobacterium tuberculosis. FEBS Lett. 2004

Interaction

Activates Rv2026c

priti.priety

IEP

Interaction

Inhibits Rv2021c

shahanup86

IEP

Interaction

Regulatory Rv2003c

shahanup86

IEP

coexpression(Functional Linkage)
authors,J. Bacon,BW. James,L. Wernisch,A. Williams,KA. Morley,GJ. Hatch,JA. Mangan,J. Hinds,NG. Stoker,PD. Butcher,PD. Marsh The influence of reduced oxygen availability on pathogenicity and gene expression in Mycobacterium tuberculosis. Tuberculosis (Edinb) 2004

Interaction

Regulatory Rv2007c

akankshajain.21

IEP

co-expression(Functional linkage)
A. Kumar,JC. Toledo,RP. Patel,JR. Lancaster,AJ. Steyn Mycobacterium tuberculosis DosS is a redox sensor and DosT is a hypoxia sensor. Proc. Natl. Acad. Sci. U.S.A. 2007

Interaction

Regulatory Rv2007c

prabhakarsmail

IEP

Interaction

Regulatory Rv1996

priyadarshinipriyanka2001

IEP

Interaction

Regulatory Rv1996

priyadarshinipriyanka2001

IEP

Co-expression (Functional linkage)
authors,SM. Hingley-Wilson,KE. Lougheed,K. Ferguson,S. Leiva,HD. Williams Individual Mycobacterium tuberculosis universal stress protein homologues are dispensable in vitro. Tuberculosis (Edinb) 2010

Interaction

Regulatory Rv1706c

shahanup86

IEP

Interaction

Regulatory Rv1706c

shahanup86

IEP

Co-expression (Functional linkage)
authors,PB. Disler,SR. Lynch,JD. Torrance,MH. Sayers,TH. Bothwell,RW. Charlton The mechanism of the inhibition of iron absorption by tea. S Afr J Med Sci 1975

Interaction

Regulatory Rv1706c

shahanup86

IEP

Co-expression (Functional linkage)
authors,PH. Chow,DK. Chan The cardiac cycle and the effects of neurohumors on myocardial contractility in the Asiatic eel Anguilla japonica, Timm. & Schle. Comp. Biochem. Physiol. C, Comp. Pharmacol. 1975

Interaction

Regulatory Rv1706c

shahanup86

IEP

Co-expression (Functional linkage)
S. Tundup, Y. Akhter et al. Clusters of PE and PPE genes of Mycobacterium tuberculosis are organized in operons: evidence that PE Rv2431c is co-transcribed with PPE Rv2430c and their gene products interact with each other. FEBS Lett. 2006

Interaction

Regulatory Rv0830

bhupender.srcp

IEP

Interaction

Regulatory Rv0830

bhupender.srcp

IEP

Interaction

Regulatory Rv0796

kandarpbioinfo

IEP

Coexpression
SL. Kendall, F. Movahedzadeh et al. The Mycobacterium tuberculosis dosRS two-component system is induced by multiple stresses. Tuberculosis (Edinburgh, Scotland) 2004

Interaction

Regulatory Rv0757

singhpankaj2116

IEP

Co-expression (Functional linkage)
ML. Chesne-Seck, N. Barilone et al. A point mutation in the two-component regulator PhoP-PhoR accounts for the absence of polyketide-derived acyltrehaloses but not that of phthiocerol dimycocerosates in Mycobacterium tuberculosis H37Ra. J. Bacteriol. 2008

Interaction

Regulatory Rv0757

singhpankaj2116

IEP

Co-expression (Functional linkage)
authors,A. Sola-Landa,RS. Moura,JF. Martn The two-component PhoR-PhoP system controls both primary metabolism and secondary metabolite biosynthesis in Streptomyces lividans. Proc. Natl. Acad. Sci. U.S.A. 2003

Interaction

Regulatory Rv0757

singhpankaj2116

IEP

Co-expression (Functional linkage)
J. Gonzalo Asensio, C. Maia et al. The virulence-associated two-component PhoP-PhoR system controls the biosynthesis of polyketide-derived lipids in Mycobacterium tuberculosis. J. Biol. Chem. 2006

Interaction

Regulatory Rv0757

singhpankaj2116

IEP

Co-expression (Functional linkage)
J. Gonzalo-Asensio, CY. Soto et al. The Mycobacterium tuberculosis phoPR operon is positively autoregulated in the virulent strain H37Rv. J. Bacteriol. 2008

Interaction

Regulatory Rv0757

singhpankaj2116

IEP

Co-expression (Functional linkage)
A. Sinha, S. Gupta et al. PhoP-PhoP interaction at adjacent PhoP binding sites is influenced by protein phosphorylation. J. Bacteriol. 2008

Interaction

Regulatory Rv0757

singhpankaj2116

IEP

Interaction

Regulatory Rv0757

singhpankaj2116

IEP

Co-expression (Functional linkage)
M. Ryndak, S. Wang et al. PhoP, a key player in Mycobacterium tuberculosis virulence. Trends Microbiol. 2008

Interaction

Regulatory Rv0757

singhpankaj2116

IEP

Co-expression (Functional linkage)
JA. Asensio, A. Arbus et al. Live tuberculosis vaccines based on phoP mutants: a step towards clinical trials. Expert opinion on biological therapy 2008

Interaction

Regulatory Rv0757

singhpankaj2116

IEP

Co-expression (Functional linkage)
SB. Walters, E. Dubnau et al. The Mycobacterium tuberculosis PhoPR two-component system regulates genes essential for virulence and complex lipid biosynthesis. Mol. Microbiol. 2006

Interaction

Regulatory Rv0757

singhpankaj2116

IEP

Co-expression (Functional linkage)
J. Gonzalo-Asensio, S. Mostowy et al. PhoP: a missing piece in the intricate puzzle of Mycobacterium tuberculosis virulence. PLoS ONE 2008

Interaction

Regulatory Rv0570

sourish10

IDA

PCR
authors,J. Nurbo,AK. Roos,D. Muthas,E. Wahlstrm,DJ. Ericsson,T. Lundstedt,T. Unge,A. Karln Design, synthesis and evaluation of peptide inhibitors of Mycobacterium tuberculosis ribonucleotide reductase. J. Pept. Sci. 2007

Interaction

Regulatory Rv0570

ahal4789

IDA

PCR
SS. Dawes, DF. Warner et al. Ribonucleotide reduction in Mycobacterium tuberculosis: function and expression of genes encoding class Ib and class II ribonucleotide reductases. Infect. Immun. 2003

Interaction

Regulatory Rv0570

ahal4789

IDA

Interaction

Regulatory Rv0570

sourish10

IDA

PCR
SS. Dawes, DF. Warner et al. Ribonucleotide reduction in Mycobacterium tuberculosis: function and expression of genes encoding class Ib and class II ribonucleotide reductases. Infect. Immun. 2003

Interaction

Regulatory Rv0256c

shahanup86

IEP

Interaction

Regulatory Rv0080

shahanup86

IEP

Co-expression (Functional linkage)

Interaction

Regulatory Rv0081

harsharohiratruefriend

TAS

Citation

Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. M. Guo, H. Feng et al. Genome Res. 2009

yamir.moreno

IDA

19228590

One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. .

Interaction

Regulates Rv2031c

yamir.moreno

IDA

One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. .
M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009

Interaction

RegulatedBy Rv3833

yamir.moreno

IDA

Interaction

RegulatedBy Rv3692

yamir.moreno

IDA

Citation

Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. M. Guo, H. Feng et al. Genome Res. 2009

yamir.moreno

IDA

19228590

One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. .

Interaction

Regulates Rv3505

yamir.moreno

IDA

Citation

Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. M. Guo, H. Feng et al. Genome Res. 2009

yamir.moreno

IDA

19228590

One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. .

Interaction

Regulates Rv3132c

yamir.moreno

IDA

Citation

Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. M. Guo, H. Feng et al. Genome Res. 2009

yamir.moreno

IDA

19228590

One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. .

Interaction

Regulates Rv3133c

yamir.moreno

IDA

Interaction

RegulatedBy Rv3133c

yamir.moreno

IDA

Citation

Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. M. Guo, H. Feng et al. Genome Res. 2009

yamir.moreno

IDA

19228590

One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. .

Interaction

Regulates Rv3134c

yamir.moreno

IDA

Citation

Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. M. Guo, H. Feng et al. Genome Res. 2009

yamir.moreno

IDA

19228590

One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. .

Interaction

Regulates Rv3504

yamir.moreno

IDA

Citation

Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. M. Guo, H. Feng et al. Genome Res. 2009

yamir.moreno

IDA

19228590

One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. .

Interaction

Regulates Rv0353

yamir.moreno

IDA

Citation

Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. M. Guo, H. Feng et al. Genome Res. 2009

yamir.moreno

IDA

19228590

One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. .

Interaction

Regulates Rv0467

yamir.moreno

IDA

Citation

Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. M. Guo, H. Feng et al. Genome Res. 2009

yamir.moreno

IDA

19228590

One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. .

Interaction

Regulates Rv0468

yamir.moreno

IDA

Citation

Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. M. Guo, H. Feng et al. Genome Res. 2009

yamir.moreno

IDA

19228590

One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. .

Interaction

Regulates Rv2590

yamir.moreno

IDA

Citation

Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. M. Guo, H. Feng et al. Genome Res. 2009

yamir.moreno

IDA

19228590

One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. .

Interaction

Regulates Rv0350

yamir.moreno

IDA

Citation

Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. M. Guo, H. Feng et al. Genome Res. 2009

yamir.moreno

IDA

19228590

One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. .

Interaction

Regulates Rv0351

yamir.moreno

IDA

Citation

Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. M. Guo, H. Feng et al. Genome Res. 2009

yamir.moreno

IDA

19228590

One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. .

Interaction

Regulates Rv0352

yamir.moreno

IDA

Interaction

RegulatedBy Rv2669

yamir.moreno

IDA

Interaction

RegulatedBy Rv2017

yamir.moreno

IDA

Interaction

RegulatedBy Rv0491

yamir.moreno

IDA

Interaction

RegulatedBy Rv0757

yamir.moreno

IEP

Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
J. Gonzalo Asensio, C. Maia et al. The virulence-associated two-component PhoP-PhoR system controls the biosynthesis of polyketide-derived lipids in Mycobacterium tuberculosis. J. Biol. Chem. 2006

Citation

The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008

yamir.moreno

TAS

18985025

Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.

Interaction

Regulates Rv3131

yamir.moreno

TAS

Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008

Citation

The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008

yamir.moreno

TAS

18985025

Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.

Interaction

Regulates Rv3134c

yamir.moreno

TAS

Citation

The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008

yamir.moreno

TAS

18985025

Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.

Interaction

Regulates Rv2006

yamir.moreno

TAS

Interaction

Regulates Rv2626c

yamir.moreno

TAS

Citation

The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008

yamir.moreno

TAS

18985025

Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.

Interaction

Regulates Rv2627c

yamir.moreno

TAS

Citation

The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008

yamir.moreno

TAS

18985025

Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.

Interaction

Regulates Rv2628

yamir.moreno

TAS

Citation

The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008

yamir.moreno

TAS

18985025

Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.

Interaction

Regulates Rv3127

yamir.moreno

TAS

Citation

The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008

yamir.moreno

TAS

18985025

Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.

Interaction

Regulates Rv3130c

yamir.moreno

TAS

Citation

The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008

yamir.moreno

TAS

18985025

Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.

Interaction

Regulates Rv2006

yamir.moreno

TAS

Citation

The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008

yamir.moreno

TAS

18985025

Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.

Interaction

Regulates Rv2007c

yamir.moreno

TAS

Citation

The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008

yamir.moreno

TAS

18985025

Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.

Interaction

Regulates Rv2031c

yamir.moreno

TAS

Citation

The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008

yamir.moreno

TAS

18985025

Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.

Interaction

Regulates Rv2032

yamir.moreno

TAS

Citation

The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008

yamir.moreno

TAS

18985025

Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.

Citation

The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008

yamir.moreno

TAS

18985025

Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.

Interaction

Regulates Rv1738

yamir.moreno

TAS

Citation

The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008

yamir.moreno

TAS

18985025

Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.

Interaction

Regulates Rv1813c

yamir.moreno

TAS

Citation

The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008

yamir.moreno

TAS

18985025

Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.

Interaction

Regulates Rv1996

yamir.moreno

TAS

Citation

The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008

yamir.moreno

TAS

18985025

Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.

Interaction

Regulates Rv2005c

yamir.moreno

TAS

Interaction

Regulates Rv0571c

yamir.moreno

TAS

Citation

The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008

yamir.moreno

TAS

18985025

Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.

Interaction

Regulates Rv0574c

yamir.moreno

TAS

Citation

The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008

yamir.moreno

TAS

18985025

Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.

Interaction

Regulates Rv1733c

yamir.moreno

TAS

Citation

The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008

yamir.moreno

TAS

18985025

Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.

Interaction

Regulates Rv1734c

yamir.moreno

TAS

Citation

The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008

yamir.moreno

TAS

18985025

Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.

Interaction

Regulates Rv1737c

yamir.moreno

TAS

Citation

The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008

yamir.moreno

TAS

18985025

Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.

Interaction

Regulates Rv0079

yamir.moreno

TAS

Citation

The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008

yamir.moreno

TAS

18985025

Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.

Citation

Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. HD. Park, KM. Guinn et al. Mol. Microbiol. 2003

yamir.moreno

IEP

12694625

Interaction

Regulates Rv3126c

yamir.moreno

IEP

Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
HD. Park, KM. Guinn et al. Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. Mol. Microbiol. 2003

Citation

Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. HD. Park, KM. Guinn et al. Mol. Microbiol. 2003

yamir.moreno

IEP

12694625

Interaction

Regulates Rv3128c

yamir.moreno

IEP

Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
HD. Park, KM. Guinn et al. Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. Mol. Microbiol. 2003

Interaction

Regulates Rv3129

yamir.moreno

IEP

Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
HD. Park, KM. Guinn et al. Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. Mol. Microbiol. 2003

Citation

Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. HD. Park, KM. Guinn et al. Mol. Microbiol. 2003

yamir.moreno

IEP

12694625

Interaction

Regulates Rv3132c

yamir.moreno

IEP

Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
HD. Park, KM. Guinn et al. Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. Mol. Microbiol. 2003

Citation

Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. HD. Park, KM. Guinn et al. Mol. Microbiol. 2003

yamir.moreno

IEP

12694625

Interaction

Regulates Rv3133c

yamir.moreno

IEP

Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
HD. Park, KM. Guinn et al. Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. Mol. Microbiol. 2003

Interaction

RegulatedBy Rv3133c

yamir.moreno

IEP

Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
HD. Park, KM. Guinn et al. Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. Mol. Microbiol. 2003

Citation

Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. HD. Park, KM. Guinn et al. Mol. Microbiol. 2003

yamir.moreno

IEP

12694625

Interaction

Regulates Rv3841

yamir.moreno

IEP

Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
HD. Park, KM. Guinn et al. Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. Mol. Microbiol. 2003

Citation

Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. HD. Park, KM. Guinn et al. Mol. Microbiol. 2003

yamir.moreno

IEP

12694625

Interaction

Regulates Rv2630

yamir.moreno

IEP

Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
HD. Park, KM. Guinn et al. Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. Mol. Microbiol. 2003

Citation

Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. HD. Park, KM. Guinn et al. Mol. Microbiol. 2003

yamir.moreno

IEP

12694625

Interaction

Regulates Rv2631

yamir.moreno

IEP

Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
HD. Park, KM. Guinn et al. Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. Mol. Microbiol. 2003

Citation

Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. HD. Park, KM. Guinn et al. Mol. Microbiol. 2003

yamir.moreno

IEP

12694625

Interaction

Regulates Rv2830c

yamir.moreno

IEP

Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
HD. Park, KM. Guinn et al. Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. Mol. Microbiol. 2003

Citation

Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. HD. Park, KM. Guinn et al. Mol. Microbiol. 2003

yamir.moreno

IEP

12694625

Citation

Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. HD. Park, KM. Guinn et al. Mol. Microbiol. 2003

yamir.moreno

IEP

12694625

Interaction

Regulates Rv2623

yamir.moreno

IEP

Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
HD. Park, KM. Guinn et al. Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. Mol. Microbiol. 2003

Citation

Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. HD. Park, KM. Guinn et al. Mol. Microbiol. 2003

yamir.moreno

IEP

12694625

Interaction

Regulates Rv2624c

yamir.moreno

IEP

Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
HD. Park, KM. Guinn et al. Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. Mol. Microbiol. 2003

Citation

Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. HD. Park, KM. Guinn et al. Mol. Microbiol. 2003

yamir.moreno

IEP

12694625

Interaction

Regulates Rv2625c

yamir.moreno

IEP

Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
HD. Park, KM. Guinn et al. Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. Mol. Microbiol. 2003

Citation

Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. HD. Park, KM. Guinn et al. Mol. Microbiol. 2003

yamir.moreno

IEP

12694625

Interaction

Regulates Rv2629

yamir.moreno

IEP

Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
HD. Park, KM. Guinn et al. Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. Mol. Microbiol. 2003

Interaction

Regulates Rv2004c

yamir.moreno

IEP

Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
HD. Park, KM. Guinn et al. Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. Mol. Microbiol. 2003

Citation

Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. HD. Park, KM. Guinn et al. Mol. Microbiol. 2003

yamir.moreno

IEP

12694625

Interaction

Regulates Rv2028c

yamir.moreno

IEP

Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
HD. Park, KM. Guinn et al. Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. Mol. Microbiol. 2003

Citation

Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. HD. Park, KM. Guinn et al. Mol. Microbiol. 2003

yamir.moreno

IEP

12694625

Interaction

Regulates Rv2029c

yamir.moreno

IEP

Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
HD. Park, KM. Guinn et al. Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. Mol. Microbiol. 2003

Citation

Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. HD. Park, KM. Guinn et al. Mol. Microbiol. 2003

yamir.moreno

IEP

12694625

Interaction

Regulates Rv2030c

yamir.moreno

IEP

Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
HD. Park, KM. Guinn et al. Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. Mol. Microbiol. 2003

Citation

Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. HD. Park, KM. Guinn et al. Mol. Microbiol. 2003

yamir.moreno

IEP

12694625

Interaction

Regulates Rv1812c

yamir.moreno

IEP

Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
HD. Park, KM. Guinn et al. Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. Mol. Microbiol. 2003

Citation

Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. HD. Park, KM. Guinn et al. Mol. Microbiol. 2003

yamir.moreno

IEP

12694625

Interaction

Regulates Rv1997

yamir.moreno

IEP

Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
HD. Park, KM. Guinn et al. Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. Mol. Microbiol. 2003

Citation

Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. HD. Park, KM. Guinn et al. Mol. Microbiol. 2003

yamir.moreno

IEP

12694625

Interaction

Regulates Rv2003c

yamir.moreno

IEP

Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
HD. Park, KM. Guinn et al. Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. Mol. Microbiol. 2003

Citation

Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. HD. Park, KM. Guinn et al. Mol. Microbiol. 2003

yamir.moreno

IEP

12694625

Citation

Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. HD. Park, KM. Guinn et al. Mol. Microbiol. 2003

yamir.moreno

IEP

12694625

Interaction

Regulates Rv0569

yamir.moreno

IEP

Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
HD. Park, KM. Guinn et al. Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. Mol. Microbiol. 2003

Citation

Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. HD. Park, KM. Guinn et al. Mol. Microbiol. 2003

yamir.moreno

IEP

12694625

Interaction

Regulates Rv0570

yamir.moreno

IEP

Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
HD. Park, KM. Guinn et al. Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. Mol. Microbiol. 2003

Citation

Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. HD. Park, KM. Guinn et al. Mol. Microbiol. 2003

yamir.moreno

IEP

12694625

Interaction

Regulates Rv0572c

yamir.moreno

IEP

Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
HD. Park, KM. Guinn et al. Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. Mol. Microbiol. 2003

Citation

Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. HD. Park, KM. Guinn et al. Mol. Microbiol. 2003

yamir.moreno

IEP

12694625

Interaction

Regulates Rv1736c

yamir.moreno

IEP

Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
HD. Park, KM. Guinn et al. Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. Mol. Microbiol. 2003

Interaction

Regulates Rv0080

yamir.moreno

IEP

Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
HD. Park, KM. Guinn et al. Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. Mol. Microbiol. 2003

Citation

Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. HD. Park, KM. Guinn et al. Mol. Microbiol. 2003

yamir.moreno

IEP

12694625

Interaction

Regulates Rv0081

yamir.moreno

IEP

Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
HD. Park, KM. Guinn et al. Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. Mol. Microbiol. 2003

Citation

Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. HD. Park, KM. Guinn et al. Mol. Microbiol. 2003

yamir.moreno

IEP

12694625

Interaction

Regulates Rv0082

yamir.moreno

IEP

Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
HD. Park, KM. Guinn et al. Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. Mol. Microbiol. 2003

Citation

Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. HD. Park, KM. Guinn et al. Mol. Microbiol. 2003

yamir.moreno

IEP

12694625

Interaction

Regulates Rv0083

yamir.moreno

IEP

Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
HD. Park, KM. Guinn et al. Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. Mol. Microbiol. 2003

Citation

Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. HD. Park, KM. Guinn et al. Mol. Microbiol. 2003

yamir.moreno

IEP

12694625

Interaction

Regulates Rv0079

yamir.moreno

IEP

Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
HD. Park, KM. Guinn et al. Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. Mol. Microbiol. 2003

Citation

Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. HD. Park, KM. Guinn et al. Mol. Microbiol. 2003

yamir.moreno

IEP

12694625

Comments