Rv3130c (tgs1)

Current annotations:
- TBCAP: (community-based annotations - see table at bottom of page)
- TBDB: acyltransferase WS/DGAT/MGAT
- REFSEQ: triacylglycerol synthase
- PATRIC: Wax ester synthase/acyl-CoA:diacylglycerol acyltransferase
- TUBERCULIST: Triacylglycerol synthase (diacylglycerol acyltransferase) Tgs1
- NCBI: Triacylglycerol synthase (diacylglycerol acyltransferase) Tgs1
- updated information (H37Rv4):
  - gene name: tgs1
  - function:
  - reference:
Type: Not Target
Start: 3494975
End: 3496366
Operon:

Trans-membrane region:
Role: V - Conserved hypotheticals
GO terms:
- GO:0071731 - response to nitric oxide (Uniprot)
- GO:0047196 - long-chain-alcohol O-fatty-acyltransferase activity (Uniprot)
- GO:0045017 - glycerolipid biosynthetic process (Uniprot)
- GO:0044119 - growth of symbiont in host cell (Uniprot)
- GO:0019432 - triglyceride biosynthetic process (Uniprot)
- GO:0016746 - transferase activity, transferring acyl groups (Uniprot)
- GO:0016740 - transferase activity (Uniprot)
- GO:0006629 - lipid metabolic process (Uniprot)
- GO:0006071 - glycerol metabolic process (Uniprot)
- GO:0005886 - plasma membrane (Uniprot)
- GO:0005618 - cell wall (Uniprot)
- GO:0004144 - diacylglycerol O-acyltransferase activity (Uniprot)
- GO:0001666 - response to hypoxia (Uniprot)
Reaction(s) (based on iSM810 metabolic model):
- 0.11 HEXACOSANOYL_COA[c] + 0.22 HEXADECANOYL_COA[c] + 0.11 9_HEXADECENOYL_COA[c] + 0.11 OCTADECANOYL_COA[c] + 0.11 9_OCTADECENOY... <Preview truncated at 128 characters>
Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
Orthologs among selected mycobacteria
Protein structure:
Search for Homologs in PDB
Top 10 Homologs in PDB (as of Nov 2020): (none with >35% aa id)
Links to additional information on tgs1:
- TBDB (updated)
- Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
- UniProt
- AlphaFold model
- Vulnerability = 0.875 (from Jeremy Rock's lab)
- KEGG - nucleotide and amino acid sequences of gene
- Mycobrowser
- PATRIC
- BioCyc
- Systems Biology

Amino Acid Sequence

MNHLTTLDAGFLKAEDVDRHVSLAIGALAVIEGPAPDQEAFLSSLAQRLRPCTRFGQRLRLRPFDLGAPKWVDDPDFDLGRHVWRIALPRPGNEDQLFEL
IADLMARRLDRGRPLWEVWVIEGLADSKWAILTKLHHCMADGIAATHLLAGLSDESMSDSFASNIHTTMQSQSASVRRGGFRVNPSEALTASTAVMAGIV
RAAKGASEIAAGVLSPAASSLNGPISDLRRYSAAKVPLADVEQVCRKFDVTINDVALAAITESYRNVLIQRGERPRFDSLRTLVPVSTRSNSALSKTDNR
VSLMLPNLPVDQENPLQRLRIVHSRLTRAKAGGQRQFGNTLMAIANRLPFPMTAWAVGLLMRLPQRGVVTVATNVPGPRRPLQIMGRRVLDLYPVSPIAM
QLRTSVAMLSYADDLYFGILADYDVVADAGQLARGIEDAVARLVAISKRRKVTRRRGALSLVV

(Nucleotide sequence available on KEGG)

Additional Information

ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across >100 conditions *new*

Classification	Condition	Strain	Method	Reference	Notes
Non-Essential	Sodium Oleate	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.000000; 3 non-insertions in a row out of 27 sites
Non-Essential	Lignoceric Acid	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.000000; 3 non-insertions in a row out of 27 sites
Non-Essential	Phosphatidylcholine	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.000000; 2 non-insertions in a row out of 27 sites
Non-Essential	minimal media + 0.1% glycerol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 0.000000; 3 non-insertions in a row out of 26 sites
Non-Essential	minimal media + 0.01% cholesterol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 0.000000; 3 non-insertions in a row out of 26 sites
No-Data	7H10-glycerol	H37RvMA	TraSH	Sassetti et al. (2003a)
Too-Short	C57BL/6J mice (8 weeks)	H37RvMA	TraSH	Sassetti et al. (2003b)	Hybridization Ratio: -1
Non-Essential	7H09/7H10 + rich media	H37RvMA	MotifHMM	DeJesus et al. (2017)	Fully saturated (14 reps).

TnSeq Data No data currently available.

No TnSeq data currently available for this Target.

RNASeq Data No data currently available.

No RNA-Seq data currently available for this Target.

Metabolomic Profiles No data currently available.

No Metabolomic data currently available for this Target.

Proteomic Data No data currently available.

No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology

BioCyc

Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

Interactions based on ChIPSeq data

Interactions based on ChIPSeq data (Minch et al. 2014)

Binds To:
- No bindings to other targets were found.
Bound By:
- Rv0472c (-) (Direct binding)
- Rv1985c (-) (Direct binding)
- Rv3133c (devR) (Direct binding)

Interactions based on TFOE data (Rustad et al. 2014)

Upregulates:
- Does not upregulate other genes.
Upregulated by:
- Rv3133c (devR)
Downregulates:
- Does not downregulate other genes.
Downregulated by:
- Not downregulated by other genes.

TBCAP

Tubculosis Community Annotation Project (

Slayden et al., 2013

Rv3130c (tgs1)

Property	Value	Creator	Evidence	PMID	Comment
Citation	Powerful induction of divergent tgs1-Rv3131 genes in Mycobacterium tuberculosis is mediated by DevR interaction with a high-affinity site and an adjacent cryptic low-affinity site. S. Chauhan,JS. Tyagi J. Bacteriol. 2009	shahanup86	IEP	19648251	Co-expression (Functional linkage)
Interaction	Regulatory Rv3133c	shahanup86	IEP		Co-expression (Functional linkage) S. Chauhan,JS. Tyagi Powerful induction of divergent tgs1-Rv3131 genes in Mycobacterium tuberculosis is mediated by DevR interaction with a high-affinity site and an adjacent cryptic low-affinity site. J. Bacteriol. 2009
Interaction	Regulatory Rv0348	priyadarshinipriyanka2001	IEP		Co-expression (Functional linkage) B. Abomoelak, EA. Hoye et al. mosR, a novel transcriptional regulator of hypoxia and virulence in Mycobacterium tuberculosis. J. Bacteriol. 2009
Interaction	RegulatedBy Rv3911	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. S. Raman, X. Puyang et al. Mycobacterium tuberculosis SigM positively regulates Esx secreted protein and nonribosomal peptide synthetase genes and down regulates virulence-associated surface lipid synthesis. J. Bacteriol. 2006
Interaction	RegulatedBy Rv0348	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. B. Abomoelak, EA. Hoye et al. mosR, a novel transcriptional regulator of hypoxia and virulence in Mycobacterium tuberculosis. J. Bacteriol. 2009
Interaction	RegulatedBy Rv0348	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. B. Abomoelak, EA. Hoye et al. mosR, a novel transcriptional regulator of hypoxia and virulence in Mycobacterium tuberculosis. J. Bacteriol. 2009
Interaction	RegulatedBy Rv1221	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. R. Manganelli, MI. Voskuil et al. The Mycobacterium tuberculosis ECF sigma factor sigmaE: role in global gene expression and survival in macrophages. Mol. Microbiol. 2001
Interaction	RegulatedBy Rv3133c	yamir.moreno	TAS		Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	RegulatedBy Rv2711	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. GM. Rodriguez, MI. Voskuil et al. ideR, An essential gene in mycobacterium tuberculosis: role of IdeR in iron-dependent gene expression, iron metabolism, and oxidative stress response. Infect. Immun. 2002
Symbol	tgs1	mjackson	IMP		Triglyceride biosynthesis
Name	acyl CoA:diacylglycerol acyltransferase	mjackson	IMP		Triglyceride biosynthesis
Symbol	tgs1	mjackson	IDA		Triglyceride biosynthesis
Name	acyl CoA:diacylglycerol acyltransferase	mjackson	IDA		Triglyceride biosynthesis
Symbol	tgs1	mjackson			acyl CoA:diacylglycerol acyltransferase (mycobacterial recombinant strain phenotype; enzymatic) TD. Sirakova, VS. Dubey et al. Identification of a diacylglycerol acyltransferase gene involved in accumulation of triacylglycerol in Mycobacterium tuberculosis under stress. Microbiology (Reading, Engl.) 2006
Citation	Identification of a diacylglycerol acyltransferase gene involved in accumulation of triacylglycerol in Mycobacterium tuberculosis under stress. TD. Sirakova, VS. Dubey et al. Microbiology (Reading, Engl.) 2006	mjackson		16946266	acyl CoA:diacylglycerol acyltransferase (mycobacterial recombinant strain phenotype; enzymatic)
Other	TBPWY:Triglyceride biosynthesis	mjackson			acyl CoA:diacylglycerol acyltransferase (mycobacterial recombinant strain phenotype; enzymatic) TD. Sirakova, VS. Dubey et al. Identification of a diacylglycerol acyltransferase gene involved in accumulation of triacylglycerol in Mycobacterium tuberculosis under stress. Microbiology (Reading, Engl.) 2006
Symbol	tgs1	mjackson			acyl CoA:diacylglycerol acyltransferase (mycobacterial recombinant strain phenotype; enzymatic) J. Daniel, C. Deb et al. Induction of a novel class of diacylglycerol acyltransferases and triacylglycerol accumulation in Mycobacterium tuberculosis as it goes into a dormancy-like state in culture. J. Bacteriol. 2004
Citation	Induction of a novel class of diacylglycerol acyltransferases and triacylglycerol accumulation in Mycobacterium tuberculosis as it goes into a dormancy-like state in culture. J. Daniel, C. Deb et al. J. Bacteriol. 2004	mjackson		15262939	acyl CoA:diacylglycerol acyltransferase (mycobacterial recombinant strain phenotype; enzymatic)
Other	TBPWY:Triglyceride biosynthesis	mjackson			acyl CoA:diacylglycerol acyltransferase (mycobacterial recombinant strain phenotype; enzymatic) J. Daniel, C. Deb et al. Induction of a novel class of diacylglycerol acyltransferases and triacylglycerol accumulation in Mycobacterium tuberculosis as it goes into a dormancy-like state in culture. J. Bacteriol. 2004
Citation	Identification of a diacylglycerol acyltransferase gene involved in accumulation of triacylglycerol in Mycobacterium tuberculosis under stress. TD. Sirakova, VS. Dubey et al. Microbiology (Reading, Engl.) 2006	extern:JZUCKER		16946266	Assay of protein purified to homogeneity from its native host
Term	EC:2.3.1.20 Diacylglycerol O-acyltransferase. - NR	extern:JZUCKER	NR		Assay of protein purified to homogeneity from its native host TD. Sirakova, VS. Dubey et al. Identification of a diacylglycerol acyltransferase gene involved in accumulation of triacylglycerol in Mycobacterium tuberculosis under stress. Microbiology (Reading, Engl.) 2006

Property

Value

Creator

Evidence

PMID

Comment

Citation

Powerful induction of divergent tgs1-Rv3131 genes in Mycobacterium tuberculosis is mediated by DevR interaction with a high-affinity site and an adjacent cryptic low-affinity site. S. Chauhan,JS. Tyagi J. Bacteriol. 2009

shahanup86

IEP

19648251

Co-expression (Functional linkage)

Interaction

Regulatory Rv3133c

shahanup86

IEP

Co-expression (Functional linkage)
S. Chauhan,JS. Tyagi Powerful induction of divergent tgs1-Rv3131 genes in Mycobacterium tuberculosis is mediated by DevR interaction with a high-affinity site and an adjacent cryptic low-affinity site. J. Bacteriol. 2009

Interaction

Regulatory Rv0348

priyadarshinipriyanka2001

IEP

Co-expression (Functional linkage)
B. Abomoelak, EA. Hoye et al. mosR, a novel transcriptional regulator of hypoxia and virulence in Mycobacterium tuberculosis. J. Bacteriol. 2009

Interaction

RegulatedBy Rv3911

yamir.moreno

IEP

Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
S. Raman, X. Puyang et al. Mycobacterium tuberculosis SigM positively regulates Esx secreted protein and nonribosomal peptide synthetase genes and down regulates virulence-associated surface lipid synthesis. J. Bacteriol. 2006

Interaction

RegulatedBy Rv0348

yamir.moreno

IEP

Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique.
B. Abomoelak, EA. Hoye et al. mosR, a novel transcriptional regulator of hypoxia and virulence in Mycobacterium tuberculosis. J. Bacteriol. 2009

Interaction

RegulatedBy Rv0348

yamir.moreno

IEP

Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique.
B. Abomoelak, EA. Hoye et al. mosR, a novel transcriptional regulator of hypoxia and virulence in Mycobacterium tuberculosis. J. Bacteriol. 2009

Interaction

RegulatedBy Rv1221

yamir.moreno

IEP

Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
R. Manganelli, MI. Voskuil et al. The Mycobacterium tuberculosis ECF sigma factor sigmaE: role in global gene expression and survival in macrophages. Mol. Microbiol. 2001

Interaction

RegulatedBy Rv3133c

yamir.moreno

TAS

Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008

Interaction

RegulatedBy Rv2711

yamir.moreno

IEP

Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
GM. Rodriguez, MI. Voskuil et al. ideR, An essential gene in mycobacterium tuberculosis: role of IdeR in iron-dependent gene expression, iron metabolism, and oxidative stress response. Infect. Immun. 2002

Symbol

tgs1

mjackson

IMP

Triglyceride biosynthesis

Name

acyl CoA:diacylglycerol acyltransferase

mjackson

IMP

Triglyceride biosynthesis

Symbol

tgs1

mjackson

IDA

Triglyceride biosynthesis

Name

acyl CoA:diacylglycerol acyltransferase

mjackson

IDA

Triglyceride biosynthesis

Symbol

tgs1

mjackson

acyl CoA:diacylglycerol acyltransferase (mycobacterial recombinant strain phenotype; enzymatic)
TD. Sirakova, VS. Dubey et al. Identification of a diacylglycerol acyltransferase gene involved in accumulation of triacylglycerol in Mycobacterium tuberculosis under stress. Microbiology (Reading, Engl.) 2006

Citation

Identification of a diacylglycerol acyltransferase gene involved in accumulation of triacylglycerol in Mycobacterium tuberculosis under stress. TD. Sirakova, VS. Dubey et al. Microbiology (Reading, Engl.) 2006

mjackson

16946266

acyl CoA:diacylglycerol acyltransferase (mycobacterial recombinant strain phenotype; enzymatic)

Other

TBPWY:Triglyceride biosynthesis

mjackson

Symbol

tgs1

mjackson

acyl CoA:diacylglycerol acyltransferase (mycobacterial recombinant strain phenotype; enzymatic)
J. Daniel, C. Deb et al. Induction of a novel class of diacylglycerol acyltransferases and triacylglycerol accumulation in Mycobacterium tuberculosis as it goes into a dormancy-like state in culture. J. Bacteriol. 2004

Citation

Induction of a novel class of diacylglycerol acyltransferases and triacylglycerol accumulation in Mycobacterium tuberculosis as it goes into a dormancy-like state in culture. J. Daniel, C. Deb et al. J. Bacteriol. 2004

mjackson

15262939

acyl CoA:diacylglycerol acyltransferase (mycobacterial recombinant strain phenotype; enzymatic)

Other

TBPWY:Triglyceride biosynthesis

mjackson

Citation

extern:JZUCKER

16946266

Assay of protein purified to homogeneity from its native host

Term

EC:2.3.1.20 Diacylglycerol O-acyltransferase. - NR

extern:JZUCKER

Assay of protein purified to homogeneity from its native host
TD. Sirakova, VS. Dubey et al. Identification of a diacylglycerol acyltransferase gene involved in accumulation of triacylglycerol in Mycobacterium tuberculosis under stress. Microbiology (Reading, Engl.) 2006

Comments