Rv3119 (moaE1)

Current annotations:
- TBCAP: (community-based annotations - see table at bottom of page)
- TBDB: molybdopterin synthase catalytic subunit
- REFSEQ: molybdenum cofactor biosynthesis protein E
- PATRIC: Molybdenum cofactor biosynthesis protein MoaE; Molybdopterin converting factor subunit 2
- TUBERCULIST: Probable molybdenum cofactor biosynthesis protein E MoaE1 (molybdopterin converting factor large subunit) (molybdopterin [MPT] converting factor subunit 2)
- NCBI: Probable molybdenum cofactor biosynthesis protein E MoaE1 (molybdopterin converting factor large subunit) (molybdopterin [MPT] converting factor, subunit 2)
- updated information (H37Rv4):
  - gene name: moaE1
  - function:
  - reference:
Type: Not Target
Start: 3485132
End: 3485575
Operon:

Trans-membrane region:
Role: I.G.4 - Molybdopterin
GO terms:
- GO:0032324 - molybdopterin cofactor biosynthetic process (Uniprot)
- GO:0030366 - molybdopterin synthase activity (Uniprot)
- GO:0016740 - transferase activity (Uniprot)
- GO:0006777 - Mo-molybdopterin cofactor biosynthetic process (Uniprot)
- GO:0005829 - cytosol (Uniprot)
Reaction(s) (based on iSM810 metabolic model):
- MOAD_COSH[c] + PRECURSOR[Z][c] -> MOAD_COOH[c] + MOLYBDOPTERIN[c]
Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
Orthologs among selected mycobacteria
Protein structure: 2wp4
Search for Homologs in PDB

Top 10 Homologs in PDB (as of Nov 2020):

PDB	aa ident	species	PDB title
2WP4	100%	MYCOBACTERIUM TUBERCULOSIS	crystal structure of Rv3119 from Mycobacterium tuberculosis
6JBZ	40%	Mycobacterium tuberculosis	Structural analysis of molybdopterin synthases from two mycobacteria pathogens
6JC0	40%	Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155)	Structural analysis of molybdopterin synthases from two mycobacteria pathogens
2QIE	38%	Staphylococcus aureus	Staphylococcus aureus molybdopterin synthase in complex with precursor Z
2Q5W	38%	Staphylococcus aureus	The X-ray Crystal Structure of Molybdopterin Synthase from Staphylococcus aureus
3BII	38%	Escherichia coli	Crystal Structure of Activated MPT Synthase
1NVJ	38%	Escherichia coli	Deletion Mutant (Delta 141) of Molybdopterin Synthase
1NVI	38%	Escherichia coli	Orthorhombic Crystal Form of Molybdopterin Synthase
1FMA	38%	Escherichia coli	MOLYBDOPTERIN SYNTHASE (MOAD/MOAE)
1FM0	38%	Escherichia coli	MOLYBDOPTERIN SYNTHASE (MOAD/MOAE)

Links to additional information on moaE1:
- TBDB (updated)
- Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
- UniProt
- AlphaFold model
- Vulnerability = 0.278 (from Jeremy Rock's lab)
- KEGG - nucleotide and amino acid sequences of gene
- Mycobrowser
- PATRIC
- BioCyc
- Systems Biology

Amino Acid Sequence

MANVVAEGAYPYCRLTDQPLSVDEVLAAVSGPEQGGIVIFVGNVRDHNAGHDVTRLFYEAYPPMVIRTLMSIIGRCEDKAEGVRVAVAHRTGELQIGDAA
VVIGASAPHRAEAFDAARMCIELLKQEVPIWKKEFSSTGAEWVGDRP

(Nucleotide sequence available on KEGG)

Additional Information

ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across >100 conditions *new*

Classification	Condition	Strain	Method	Reference	Notes
Non-Essential	Sodium Oleate	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.000000; 1 non-insertions in a row out of 12 sites
Non-Essential	Lignoceric Acid	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.000000; 1 non-insertions in a row out of 12 sites
Non-Essential	Phosphatidylcholine	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.000000; 0 non-insertions in a row out of 12 sites
Non-Essential	minimal media + 0.1% glycerol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 0.000000; 0 non-insertions in a row out of 12 sites
Non-Essential	minimal media + 0.01% cholesterol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 0.000000; 2 non-insertions in a row out of 12 sites
No-Data	7H10-glycerol	H37RvMA	TraSH	Sassetti et al. (2003a)
Too-Short	C57BL/6J mice (8 weeks)	H37RvMA	TraSH	Sassetti et al. (2003b)	Hybridization Ratio: -1
Growth-Advantage	7H09/7H10 + rich media	H37RvMA	MotifHMM	DeJesus et al. (2017)	Fully saturated (14 reps).

TnSeq Data No data currently available.

No TnSeq data currently available for this Target.

RNASeq Data No data currently available.

No RNA-Seq data currently available for this Target.

Metabolomic Profiles No data currently available.

No Metabolomic data currently available for this Target.

Proteomic Data No data currently available.

No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology

BioCyc

Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

Interactions based on ChIPSeq data

Binds To:
- No bindings to other targets were found.
Bound By:

Interactions based on ChIPSeq data (Minch et al. 2014)

Binds To:
- No bindings to other targets were found.
Bound By:
- Rv0757 (phoP) (Direct binding)
- Rv1473A (-) (Direct binding)
- Rv1816 (-) (Upstream of operon)

Interactions based on TFOE data (Rustad et al. 2014)

Upregulates:
- Does not upregulate other genes.
Upregulated by:
- Rv3286c (sigF)
Downregulates:
- Does not downregulate other genes.
Downregulated by:
- Rv0260c (-)
- Rv3849 (espR)

Property	Value	Creator	PMID	Comment
Citation	Functional analysis of molybdopterin biosynthesis in mycobacteria identifies a fused molybdopterin synthase in Mycobacterium tuberculosis. authors,MJ. Williams,BD. Kana,V. Mizrahi J. Bacteriol. 2011	mwilliams	20971904	Expression in M. smegmatis moaE mutant restores MoCo biosynthesis
Citation	In silico reconstruction of the metabolic pathways of Lactobacillus plantarum: comparing predictions of nutrient requirements with those from growth experiments. authors,B. Teusink,FH. van Enckevort,C. Francke,A. Wiersma,A. Wegkamp,EJ. Smid,RJ. Siezen Appl. Environ. Microbiol. 2005	jjmcfadden	16269766	Inferred from direct assay
Other	EC:	jjmcfadden		Inferred from direct assay authors,B. Teusink,FH. van Enckevort,C. Francke,A. Wiersma,A. Wegkamp,EJ. Smid,RJ. Siezen In silico reconstruction of the metabolic pathways of Lactobacillus plantarum: comparing predictions of nutrient requirements with those from growth experiments. Appl. Environ. Microbiol. 2005

TB Genome Annotation Portal