TB Genome Annotation Portal

Rv3116 (moeB2)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: molybdopterin biosynthesis protein MoeB
  • REFSEQ: molybdenum cofactor biosynthesis protein MoeB
  • PATRIC: Sulfur carrier protein adenylyltransferase ThiF
  • TUBERCULIST: Probable molybdenum cofactor biosynthesis protein MoeB2 (MPT-synthase sulfurylase) (molybdopterin synthase sulphurylase)
  • NCBI: Probable molybdenum cofactor biosynthesis protein MoeB2 (MPT-synthase sulfurylase) (molybdopterin synthase sulphurylase)
  • updated information (H37Rv4):
    • gene name: moeB2
    • function: aka 'moeBR'
    • reference: Voss (2011); PMID: 22140533
• Coordinates in H37Rv: 3482776 - 3483945
• Gene length: 1170 bp (with stop codon), 389 aa (without stop codon)
• Operon:


• Trans-membrane region:
  
• Role: I.G.4 - Molybdopterin
• GO terms:
  • GO:0016779 - nucleotidyltransferase activity (Uniprot)
  • GO:0008641 - ubiquitin-like modifier activating enzyme activity (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
  • GTP[c] -> PPI[c] + PRECURSOR[Z][c]
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure:
• Search for Latest Homologs in PDB
• Top 10 Homologs in PDB (as of Apr 2026):
  

  PDB	aa ident	species	PDB title
  6YUB	46%	Chaetomium thermophilum	Crystal structure of Uba4 from Chaetomium thermophilum
  6Z6S	45%	Chaetomium thermophilum var. thermophilum DSM 1495	Crystal structure of Uba4-Urm1 from Chaetomium thermophilum
  6YUC	45%	Chaetomium thermophilum	Crystal structure of Uba4-Urm1 from Chaetomium thermophilum
  5VE3	44%	Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)	Crystal structure of wild-type persulfide dioxygenase-rhodanese fusion protein from Burkholderia phytofirmans
  5VE5	43%	Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)	Crystal structure of persulfide dioxygenase rhodanese fusion protein with rhodanese domain inactivating mutation (C314S) from Burkholderia phytofirmans in complex with glutathione
  5VE4	43%	Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)	Crystal structure of persulfide dioxygenase-rhodanese fusion protein with rhodanese domain inactivating mutation (C314S) from Burkholderia phytofirmans
  3ICT	41%	Bacillus anthracis	Crystal structure of reduced Bacillus anthracis CoADR-RHD
  3ICS	41%	Bacillus anthracis	Crystal structure of partially reduced Bacillus anthracis CoADR-RHD
  3ICR	41%	Bacillus anthracis	Crystal structure of oxidized Bacillus anthracis CoADR-RHD
  1JWB	40%	Escherichia coli	Structure of the Covalent Acyl-Adenylate Form of the MoeB-MoaD Protein Complex

• Links to additional information on moeB2:
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = 1.262 (from Jeremy Rock's lab)
  • KEGG - nucleotide and amino acid sequences of gene
  • Mycobrowser
  • PATRIC
  • BioCyc
  • Systems Biology

Amino Acid Sequence

MTEALIPAPSQISLTRDEVRRYSRHLIIPDIGVNGQQRLKDARVLCIGAGGLGSPALLYLAAAGVGTIGIIDGDHVDESNLQRQIIHGTSDVGRPKVESA
AEAVAEINPHVRVTQYREMLTHDNALEIFGDHDLIVDGTDNFTTRYLINDAAVLAGKPYVWGSIYRFNGQTSVFWPGRGPCYRCLHPAPPPPGLVPSCAE
GGVLGAICATIASIQVTEVLKLLTGVGTPLVGRLLMYEALDATYHQIRIAKNPDCAICGDAPTITELVDDSVSCASTQSVDPELVISCDELRTKQQSDQN
FLLVDVREPAEFDIAHIPGSILIPKGEIGSAAGLAQLPLDKEIVLYCKSGIRSAQALTTLKAAGLHNVKHLDGGIAEWTRTIDSSLLVY

Additional Information

Analysis of Positive Selection in Clinical Isolates *new*

• data from Culviner et al (2025) (55,259 Mtb clinical isolates)
  • overall pN/pS for Rv3116: 0.765036223
  • lineage-specific pN/pS in L1: 0.715792989
  • lineage-specific pN/pS in L2: 0.992656316
  • lineage-specific pN/pS in L3: 1.050429964
  • lineage-specific pN/pS in L4: 0.656209777

• Analysis of dN/dS (omega) in a global collection of 10k Mtb clinical isolates using GenomegaMap (Window model)
• clinical isolates collection: global set of 10,626 Mtb genomes
• In the omega plots, the black line shows the mean estimate of omega (dN/dS) at each codon, and the blue lines are the bounds for the 95% credible interval (95%CI, from MCMC sampling).
• A gene is under significant positive selection if the lower-bound of the 95%CI of omega (lower blue line) exceeds 1.0 at any codon.

	global set of 10,626 Mtb clinical isolates
under significant positive selection?	NO
omega peak height (95%CI lower bound)	1.6 (0.85)
codons under selection
omega plots
genetic variants*	link