TB Genome Annotation Portal

Rv3111 (moaC1)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: molybdenum cofactor biosynthesis protein C 1
  • REFSEQ: molybdenum cofactor biosynthesis protein C
  • PATRIC: Molybdenum cofactor biosynthesis protein MoaC
  • TUBERCULIST: Probable molybdenum cofactor biosynthesis protein C MoaC1
  • NCBI: Probable molybdenum cofactor biosynthesis protein C MoaC1
  • updated information (H37Rv4):
    • gene name: moaC1
    • function:
    • reference:
• Type: Not Target
• Start: 3479171
• End: 3479683
• Operon:


• Trans-membrane region:
  
• Role: I.G.4 - Molybdopterin
• GO terms:
  • GO:0061799 - cyclic pyranopterin monophosphate synthase activity (Uniprot)
  • GO:0052170 - negative regulation by symbiont of host innate immune response (Uniprot)
  • GO:0040007 - growth (Uniprot)
  • GO:0016829 - lyase activity (Uniprot)
  • GO:0006777 - Mo-molybdopterin cofactor biosynthetic process (Uniprot)
  • GO:0005576 - extracellular region (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
  • GTP[c] -> PPI[c] + PRECURSOR[Z][c]
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure:
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020):
  

  PDB	aa ident	species	PDB title
  4PYD	58%	Escherichia coli	MoaC in complex with cPMP crystallized in space group P212121
  1EKR	58%	Escherichia coli	MOAC PROTEIN FROM E. COLI
  4PYA	57%	Escherichia coli K-12	MoaC K51A in complex with 3',8-cH2GTP
  1EKS	57%	Escherichia coli	ASP128ALA VARIANT OF MOAC PROTEIN FROM E. COLI
  4FDF	54%	Mycobacterium tuberculosis	Structural insights into putative molybdenum cofactor biosynthesis protein C (MoaC2) from Mycobacterium tuberculosis H37Rv
  3JQM	50%	Thermus thermophilus	Binding of 5'-GTP to molybdenum cofactor biosynthesis protein MoaC from Thermus theromophilus HB8
  3JQK	50%	Thermus thermophilus	Crystal structure of the molybdenum cofactor biosynthesis protein C (TTHA1789) from Thermus Theromophilus HB8 (H32 FORM)
  3JQJ	50%	Thermus thermophilus	Crystal structure of the molybdenum cofactor biosynthesis protein C (TTHA1789) from Thermus Theromophilus HB8
  2IIH	50%	Thermus thermophilus	Crystal structure of the molybdenum cofactor biosynthesis protein C (TTHA1789) from thermus theromophilus HB8 (H32 form)
  2IDE	50%	Thermus thermophilus	Crystal Structure of the molybdenum cofactor biosynthesis protein C (TTHA1789) from Thermus Theromophilus HB8

• Links to additional information on moaC1:
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = 1.666 (from Jeremy Rock's lab)
  • KEGG - nucleotide and amino acid sequences of gene
  • Mycobrowser
  • PATRIC
  • BioCyc
  • Systems Biology

Amino Acid Sequence

MIDHALALTHIDERGAARMVDVSEKPVTLRVAKASGLVIMKPSTLRMISDGAAAKGDVMAAARIAGIAAAKRTGDLIPLCHPLGLDAVSVTITPCEPDRV
KILATTTTLGRTGVEMEALTAVSVAALTIYDMCKAVDRAMEISQIVLQEKSGGRSGVYRRSASDLACQSR

Additional Information