TB Genome Annotation Portal

Rv3109 (moaA1)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: molybdenum cofactor biosynthesis protein A 1
  • REFSEQ: molybdenum cofactor biosynthesis protein A
  • TUBERCULIST: Probable molybdenum cofactor biosynthesis protein A MoaA1
  • NCBI: Probable molybdenum cofactor biosynthesis protein A MoaA1
  • updated information (H37Rv4):
    • gene name: moaA1
    • function:
    • reference:
• Type: Not Target
• Start: 3477649
• End: 3478728
• Operon:


• Trans-membrane region:
  
• Role: I.G.4 - Molybdopterin
• GO terms:
  • GO:0061798 - GTP 3',8'-cyclase activity (Uniprot)
  • GO:0051539 - 4 iron, 4 sulfur cluster binding (Uniprot)
  • GO:0051536 - iron-sulfur cluster binding (Uniprot)
  • GO:0046872 - metal ion binding (Uniprot)
  • GO:0040007 - growth (Uniprot)
  • GO:0019008 - molybdopterin synthase complex (Uniprot)
  • GO:0016829 - lyase activity (Uniprot)
  • GO:0006777 - Mo-molybdopterin cofactor biosynthetic process (Uniprot)
  • GO:0005886 - plasma membrane (Uniprot)
  • GO:0005525 - GTP binding (Uniprot)
  • GO:0003824 - catalytic activity (Uniprot)
  • GO:0000166 - nucleotide binding (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
  • GTP[c] -> PPI[c] + PRECURSOR[Z][c]
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure:
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020):
  

  PDB	aa ident	species	PDB title
  2FB3	38%	Staphylococcus aureus	Structure of MoaA in complex with 5'-GTP
  1TV8	38%	Staphylococcus aureus	Structure of MoaA in complex with S-adenosylmethionine
  1TV7	38%	Staphylococcus aureus	Structure of the S-adenosylmethionine dependent Enzyme MoaA
  2FB2	37%	Staphylococcus aureus	Structure of the MoaA Arg17/266/268/Ala triple mutant

• Links to additional information on moaA1:
  • KEGG - nucleotide and amino acid sequences of gene
  • Mycobrowser
  • PATRIC
  • BioCyc
  • Systems Biology
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = 1.107 (from Jeremy Rock's lab)

Amino Acid Sequence

MSTPTLPDMVAPSPRVRVKDRCRRMMGDLRLSVIDQCNLRCRYCMPEEHYTWLPRQDLLSVKEISAIVDVFLSVGVSKVRITGGEPLIRPDLPEIVRTLS
AKVGEDSGLRDLAITTNGVLLADRVDGLKAAGMKRITVSLDTLQPERFKAISQRNSHDKVIAGIKAVAAAGFTDTKIDTTVMRGANHDELADLIEFARTV
NAEVRFIEYMDVGGATHWAWEKVFTKANMLESLEKRYGRIEPLPKHDTAPANRYALPDGTTFGIIASTTEPFCATCDRSRLTADGLWLHCLYAISGINLR
EPLRAGATHDDLVETVTTGWRRRTDRGAEQRLAQRERGVFLPLSTLKADPHLEMHTRGG

Additional Information

Analysis of Positive Selection in Clinical Isolates *new*

• Analysis of dN/dS (omega) in two collections of Mtb clinical isolates using GenomegaMap (Window model) (see description of methods)
  • Moldova: 2,057 clinical isolates
  • global set: 5,195 clinical isolates from 15 other countries
• In the omega plots, the black line shows the mean estimate of omega (dN/dS) at each codon, and the blue lines are the bounds for the 95% credible interval (95%CI, from MCMC sampling).
• A gene is under significant positive selection if the lower-bound of the 95%CI of omega (lower blue line) exceeds 1.0 at any codon.

	Moldova (2,057)	global set (5,195)
under significant positive selection?	YES	YES
omega peak height (95%CI lower bound)	3.11 (1.09)	1.84 (1.02)
codons under selection	200, 201, 202, 203, 204	335, 336, 337, 338
omega plots
genetic variants*	link	link
statistics at each codon	link	link