TB Genome Annotation Portal

Rv3109 (moaA1)

Amino Acid Sequence

MSTPTLPDMVAPSPRVRVKDRCRRMMGDLRLSVIDQCNLRCRYCMPEEHYTWLPRQDLLSVKEISAIVDVFLSVGVSKVRITGGEPLIRPDLPEIVRTLS
AKVGEDSGLRDLAITTNGVLLADRVDGLKAAGMKRITVSLDTLQPERFKAISQRNSHDKVIAGIKAVAAAGFTDTKIDTTVMRGANHDELADLIEFARTV
NAEVRFIEYMDVGGATHWAWEKVFTKANMLESLEKRYGRIEPLPKHDTAPANRYALPDGTTFGIIASTTEPFCATCDRSRLTADGLWLHCLYAISGINLR
EPLRAGATHDDLVETVTTGWRRRTDRGAEQRLAQRERGVFLPLSTLKADPHLEMHTRGG
(Nucleotide sequence available on KEGG)

Additional Information



ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across >100 conditions *new*

Classification Condition Strain Method Reference Notes
Uncertain Sodium Oleate H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: 0.943400;
12 non-insertions in a row out of 41 sites
Uncertain Lignoceric Acid H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: 0.988850;
12 non-insertions in a row out of 41 sites
Uncertain Phosphatidylcholine H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: 0.271700;
9 non-insertions in a row out of 41 sites
Essential minimal media + 0.1% glycerol H37RvMA Gumbel Griffin et al. (2011) Probability of Essentiality: 0.999850;
14 non-insertions in a row out of 42 sites
Essential minimal media + 0.01% cholesterol H37RvMA Gumbel Griffin et al. (2011) Probability of Essentiality: 0.999950;
17 non-insertions in a row out of 42 sites
Essential 7H10-glycerol H37RvMA TraSH Sassetti et al. (2003a)
Essential C57BL/6J mice (8 weeks) H37RvMA TraSH Sassetti et al. (2003b) Hybridization Ratio: 0.07
Non-Essential 7H09/7H10 + rich media H37RvMA MotifHMM DeJesus et al. (2017) Fully saturated (14 reps).

TnSeq Data No data currently available.
  • No TnSeq data currently available for this Target.
RNASeq Data No data currently available.
  • No RNA-Seq data currently available for this Target.
Metabolomic Profiles No data currently available.
  • No Metabolomic data currently available for this Target.
Proteomic Data No data currently available.
  • No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology
  • BioCyc

    Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

    NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

    Interactions based on ChIPSeq data

  • Interactions based on ChIPSeq data (Minch et al. 2014)

    • Binds To:

      • No bindings to other targets were found.
    • Bound By:

    Interactions based on TFOE data (Rustad et al. 2014)



    TBCAP

    Tubculosis Community Annotation Project (
    Slayden et al., 2013)

    Rv3109 (moaA1)

    PropertyValueCreatorEvidencePMIDComment
    InteractionPhysicalInteraction Rv3324Apriti.prietyNASCo-occurrence(Functional-linkage)
    authors,MS. Cortese,AB. Caplan,RL. Crawford Structural, functional, and evolutionary analysis of moeZ, a gene encoding an enzyme required for the synthesis of the Pseudomonas metabolite, pyridine-2,6-bis(thiocarboxylic acid). BMC Evol. Biol. 2002
    InteractionPhysicalInteraction Rv3324cpriti.prietyNASCo-occurrence(Functional-linkage)
    authors,PR. Marri,JP. Bannantine,GB. Golding Comparative genomics of metabolic pathways in Mycobacterium species: gene duplication, gene decay and lateral gene transfer. FEMS Microbiol. Rev. 2006
    InteractionPhysicalInteraction Rv3324Apriti.prietyNASCo-occurrence(Functional-linkage)
    authors,PR. Marri,JP. Bannantine,GB. Golding Comparative genomics of metabolic pathways in Mycobacterium species: gene duplication, gene decay and lateral gene transfer. FEMS Microbiol. Rev. 2006
    InteractionRegulatory Rv3124kaveri.vermaIPIAffinity purification (Physical interaction)
    P. Mendoza Lopez,P. Golby,E. Wooff,JN. Garcia,MC. Garcia Pelayo,K. Conlon,A. Gema Camacho,RG. Hewinson,J. Polaina,A. Surez Garca,SV. Gordon Characterisation of the transcriptional regulator Rv3124 of Mycobacterium tuberculosis identifies it as a positive regulator of molybdopterin biosynthesis and defines the functional consequences of a nonsynonymous SNP in the Mycobacterium bovis BCG orthologue. Microbiology (Reading, England) 2010
    CitationFunctional analysis of molybdopterin biosynthesis in mycobacteria identifies a fused molybdopterin synthase in Mycobacterium tuberculosis. authors,MJ. Williams,BD. Kana,V. Mizrahi J. Bacteriol. 2011mwilliams20971904Deletion of moaA1-moaB1-moaC1-moaD1 in M. tuberculosis results in reduced MoCo biosynthesis
    CitationCharacterisation of the transcriptional regulator Rv3124 of Mycobacterium tuberculosis identifies it as a positive regulator of molybdopterin biosynthesis and defines the functional consequences of a nonsynonymous SNP in the Mycobacterium bovis BCG orthologue. P. Mendoza Lopez,P. Golby,E. Wooff,JN. Garcia,MC. Garcia Pelayo,K. Conlon,A. Gema Camacho,RG. Hewinson,J. Polaina,A. Surez Garca,SV. Gordon Microbiology (Reading, England) 2010mwilliams20378651Rv3124 is a positive transcriptional regulator of moaA1-moaB1-moaC1-moaD1
    CitationInsights from the complete genome sequence of Mycobacterium marinum on the evolution of Mycobacterium tuberculosis. authors,TP. Stinear,T. Seemann,PF. Harrison,GA. Jenkin,JK. Davies,PD. Johnson,Z. Abdellah,C. Arrowsmith,T. Chillingworth,C. Churcher,K. Clarke,A. Cronin,P. Davis,I. Goodhead,N. Holroyd,K. Jagels,A. Lord,S. Moule,K. Mungall,H. Norbertczak,MA. Quail,E. Rabbinowitsch,D. Walker,B. White,S. Whitehead,PL. Small,R. Brosch,L. Ramakrishnan,MA. Fischbach,J. Parkhill,ST. Cole Genome Res. 2008mwilliams18403782Acquired by horizontal gene transfer
    CitationIn silico reconstruction of the metabolic pathways of Lactobacillus plantarum: comparing predictions of nutrient requirements with those from growth experiments. authors,B. Teusink,FH. van Enckevort,C. Francke,A. Wiersma,A. Wegkamp,EJ. Smid,RJ. Siezen Appl. Environ. Microbiol. 2005jjmcfadden16269766Inferred from direct assay
    OtherEC:jjmcfaddenInferred from direct assay
    authors,B. Teusink,FH. van Enckevort,C. Francke,A. Wiersma,A. Wegkamp,EJ. Smid,RJ. Siezen In silico reconstruction of the metabolic pathways of Lactobacillus plantarum: comparing predictions of nutrient requirements with those from growth experiments. Appl. Environ. Microbiol. 2005

    Comments