Rv3088 (tgs4)

Current annotations:
- TBCAP: (community-based annotations - see table at bottom of page)
- TBDB: acyltransferase WS/DGAT/MGAT
- REFSEQ: hypothetical protein
- PATRIC: Wax ester synthase/acyl-CoA:diacylglycerol acyltransferase
- TUBERCULIST: Putative triacylglycerol synthase (diacylglycerol acyltransferase) Tgs4
- NCBI: Putative triacylglycerol synthase (diacylglycerol acyltransferase) Tgs4
- updated information (H37Rv4):
  - gene name: tgs4
  - function:
  - reference:
Type: Not Target
Start: 3454340
End: 3455764
Operon:

Trans-membrane region:
Role: V - Conserved hypotheticals
GO terms:
- GO:0071731 - response to nitric oxide (Uniprot)
- GO:0047196 - long-chain-alcohol O-fatty-acyltransferase activity (Uniprot)
- GO:0045017 - glycerolipid biosynthetic process (Uniprot)
- GO:0044119 - growth of symbiont in host cell (Uniprot)
- GO:0019432 - triglyceride biosynthetic process (Uniprot)
- GO:0016746 - transferase activity, transferring acyl groups (Uniprot)
- GO:0016740 - transferase activity (Uniprot)
- GO:0010447 - response to acidic pH (Uniprot)
- GO:0006629 - lipid metabolic process (Uniprot)
- GO:0006071 - glycerol metabolic process (Uniprot)
- GO:0005886 - plasma membrane (Uniprot)
- GO:0005618 - cell wall (Uniprot)
- GO:0004144 - diacylglycerol O-acyltransferase activity (Uniprot)
- GO:0001666 - response to hypoxia (Uniprot)
Reaction(s) (based on iSM810 metabolic model):
- 0.11 HEXACOSANOYL_COA[c] + 0.22 HEXADECANOYL_COA[c] + 0.11 9_HEXADECENOYL_COA[c] + 0.11 OCTADECANOYL_COA[c] + 0.11 9_OCTADECENOY... <Preview truncated at 128 characters>
Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
Orthologs among selected mycobacteria
Protein structure:
Search for Homologs in PDB
Top 10 Homologs in PDB (as of Nov 2020): (none with >35% aa id)
Links to additional information on tgs4:
- TBDB (updated)
- Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
- UniProt
- AlphaFold model
- Vulnerability = 1.02 (from Jeremy Rock's lab)
- KEGG - nucleotide and amino acid sequences of gene
- Mycobrowser
- PATRIC
- BioCyc
- Systems Biology

Amino Acid Sequence

MTRINPIDLSFLLLERANRPNHMAAYTIFEKPKGQKSSFGPRLFDAYRHSQAAKPFNHKLKWLGTDVAAWETVEPDMGYHIRHLALPAPGSMQQFHETVS
FLNTGLLDRGHPMWECYIIDGIERGRIAILLKVHHALIDGEGGLRAMRNFLSDSPDDTTLAGPWMSAQGADRPRRTPATVSRRAQLQGQLQGMIKGLTKL
PSGLFGVSADAADLGAQALSLKARKASLPFTARRTLFNNTAKSAARAYGNVELPLADVKALAKATGTSVNDVVMTVIDDALHHYLAEHQASTDRPLVAFM
PMSLREKSGEGGGNRVSAELVPMGAPKASPVERLKEINAATTRAKDKGRGMQTTSRQAYALLLLGSLTVADALPLLGKLPSANVVISNMKGPTEQLYLAG
APLVAFSGLPIVPPGAGLNVTFASINTALCIAIGAAPEAVHEPSRLAELMQRAFTELQTEAGTTSPTTSKSRTP

(Nucleotide sequence available on KEGG)

Additional Information

ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across >100 conditions *new*

Classification	Condition	Strain	Method	Reference	Notes
Non-Essential	Sodium Oleate	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.000000; 3 non-insertions in a row out of 13 sites
Non-Essential	Lignoceric Acid	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.000000; 2 non-insertions in a row out of 13 sites
Non-Essential	Phosphatidylcholine	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.000000; 2 non-insertions in a row out of 13 sites
Non-Essential	minimal media + 0.1% glycerol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 0.000000; 1 non-insertions in a row out of 13 sites
Non-Essential	minimal media + 0.01% cholesterol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 0.000000; 1 non-insertions in a row out of 13 sites
Non-Essential	7H10-glycerol	H37RvMA	TraSH	Sassetti et al. (2003a)
Non-Essential	C57BL/6J mice (8 weeks)	H37RvMA	TraSH	Sassetti et al. (2003b)	Hybridization Ratio: 0.73
Non-Essential	7H09/7H10 + rich media	H37RvMA	MotifHMM	DeJesus et al. (2017)	Fully saturated (14 reps).

TnSeq Data No data currently available.

No TnSeq data currently available for this Target.

RNASeq Data No data currently available.

No RNA-Seq data currently available for this Target.

Metabolomic Profiles No data currently available.

No Metabolomic data currently available for this Target.

Proteomic Data No data currently available.

No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology

BioCyc

Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

Interactions based on ChIPSeq data

Binds To:
- No bindings to other targets were found.
Bound By:

Interactions based on ChIPSeq data (Minch et al. 2014)

Binds To:
- No bindings to other targets were found.
Bound By:
- Rv0494 (-) (Direct binding)
- Rv3133c (devR) (Direct binding)
- Rv1956 (higA) (Upstream of operon)
- Rv3082c (virS) (Upstream of operon)
- Rv3736 (-) (Upstream of operon)

Interactions based on TFOE data (Rustad et al. 2014)

Upregulates:
- Does not upregulate other genes.
Upregulated by:
Downregulates:
- Does not downregulate other genes.
Downregulated by:
- Not downregulated by other genes.

TBCAP

Tubculosis Community Annotation Project (

Slayden et al., 2013

Rv3088 (tgs4)

Property	Value	Creator	Evidence	PMID	Comment
Interaction	Transcription Rv3089	sourish10	NAS		Operon (Functional linkage) A. Singh, S. Jain et al. mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. FEMS Microbiol. Lett. 2003
Citation	mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. A. Singh, S. Jain et al. FEMS Microbiol. Lett. 2003	sourish10	IEP	14568148	Co-expression (Functional linkage)
Interaction	Transcription Rv3082c	sourish10	IEP		Co-expression (Functional linkage) A. Singh, S. Jain et al. mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. FEMS Microbiol. Lett. 2003
Citation	The Mycobacterium tuberculosis protein kinase K modulates activation of transcription from the promoter of mycobacterial monooxygenase operon through phosphorylation of the transcriptional regulator VirS. P. Kumar, D. Kumar et al. J. Biol. Chem. 2009	sourish10	IDA	19251699	Spectrophotometric
Interaction	Activation Rv3080c	sourish10	IDA		Spectrophotometric P. Kumar, D. Kumar et al. The Mycobacterium tuberculosis protein kinase K modulates activation of transcription from the promoter of mycobacterial monooxygenase operon through phosphorylation of the transcriptional regulator VirS. J. Biol. Chem. 2009
Citation	The Mycobacterium tuberculosis protein kinase K modulates activation of transcription from the promoter of mycobacterial monooxygenase operon through phosphorylation of the transcriptional regulator VirS. P. Kumar, D. Kumar et al. J. Biol. Chem. 2009	sourish10	IDA	19251699	Structural Analysis
Interaction	Activation Rv3080c	sourish10	IDA		Structural Analysis P. Kumar, D. Kumar et al. The Mycobacterium tuberculosis protein kinase K modulates activation of transcription from the promoter of mycobacterial monooxygenase operon through phosphorylation of the transcriptional regulator VirS. J. Biol. Chem. 2009
Citation	mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. A. Singh, S. Jain et al. FEMS Microbiol. Lett. 2003	sourish10	NAS	14568148	Operon (Functional linkage)
Interaction	Transcription Rv3083	sourish10	NAS		Operon (Functional linkage) A. Singh, S. Jain et al. mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. FEMS Microbiol. Lett. 2003
Interaction	Transcription Rv3084	sourish10	NAS		Operon (Functional linkage) A. Singh, S. Jain et al. mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. FEMS Microbiol. Lett. 2003
Interaction	Transcription Rv3086	sourish10	NAS		Operon (Functional linkage) A. Singh, S. Jain et al. mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. FEMS Microbiol. Lett. 2003
Interaction	Transcription Rv3087	sourish10	NAS		Operon (Functional linkage) A. Singh, S. Jain et al. mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. FEMS Microbiol. Lett. 2003
Interaction	Transcription Rv3085	sourish10	NAS		Operon (Functional linkage) A. Singh, S. Jain et al. mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. FEMS Microbiol. Lett. 2003
Interaction	Transcription Rv3085	sourish10	IEP		Co-expression (Functional linkage) A. Singh, S. Jain et al. mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. FEMS Microbiol. Lett. 2003
Interaction	Transcription Rv3084	sourish10	IEP		Co-expression (Functional linkage) A. Singh, S. Jain et al. mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. FEMS Microbiol. Lett. 2003
Interaction	Transcription Rv3083	priyadarshinipriyanka2001	IEP		Co-expression (Functional linkage) A. Singh, S. Jain et al. mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. FEMS Microbiol. Lett. 2003
Interaction	Transcription Rv3082c	priyadarshinipriyanka2001	IEP		Co-expression (Functional linkage) A. Singh, S. Jain et al. mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. FEMS Microbiol. Lett. 2003
Interaction	Transcription Rv3082c	priyadarshinipriyanka2001	IEP		Co-expression (Functional linkage) P. Kumar, D. Kumar et al. The Mycobacterium tuberculosis protein kinase K modulates activation of transcription from the promoter of mycobacterial monooxygenase operon through phosphorylation of the transcriptional regulator VirS. J. Biol. Chem. 2009
Interaction	Transcription Rv3082c	priyadarshinipriyanka2001	IEP		Co-expression (Functional linkage) A. Singh, R. Gupta et al. Requirement of the mymA operon for appropriate cell wall ultrastructure and persistence of Mycobacterium tuberculosis in the spleens of guinea pigs. J. Bacteriol. 2005
Interaction	RegulatedBy Rv3082c	yamir.moreno	IEP		LacZ-promoter fusion. expression levels of LacZ- regulated promoter fusion measured and compared between wild-type and trans-element mutation (knockout, over expression etc.). Gfp-promoter fusion. expression levels of gfp-regulated promoter fusion measured and compared between wild-type and trans-element mutation (knockout, over expression etc.). A. Singh, S. Jain et al. mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. FEMS Microbiol. Lett. 2003
Interaction	RegulatedBy Rv3082c	yamir.moreno	IEP		LacZ-promoter fusion. expression levels of LacZ- regulated promoter fusion measured and compared between wild-type and trans-element mutation (knockout, over expression etc.). Gfp-promoter fusion. expression levels of gfp-regulated promoter fusion measured and compared between wild-type and trans-element mutation (knockout, over expression etc.). A. Singh, S. Jain et al. mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. FEMS Microbiol. Lett. 2003
Symbol	tgs4	mjackson	IDA		Triglyceride biosynthesis
Name	Putative acyl CoA:diacylglycerol acyltransferase	mjackson	IDA		Triglyceride biosynthesis
Symbol	tgs4	mjackson			Putative acyl CoA:diacylglycerol acyltransferase (enzymatic) J. Daniel, C. Deb et al. Induction of a novel class of diacylglycerol acyltransferases and triacylglycerol accumulation in Mycobacterium tuberculosis as it goes into a dormancy-like state in culture. J. Bacteriol. 2004
Citation	Induction of a novel class of diacylglycerol acyltransferases and triacylglycerol accumulation in Mycobacterium tuberculosis as it goes into a dormancy-like state in culture. J. Daniel, C. Deb et al. J. Bacteriol. 2004	mjackson		15262939	Putative acyl CoA:diacylglycerol acyltransferase (enzymatic)
Other	TBPWY:Triglyceride biosynthesis	mjackson			Putative acyl CoA:diacylglycerol acyltransferase (enzymatic) J. Daniel, C. Deb et al. Induction of a novel class of diacylglycerol acyltransferases and triacylglycerol accumulation in Mycobacterium tuberculosis as it goes into a dormancy-like state in culture. J. Bacteriol. 2004

Property

Value

Creator

Evidence

PMID

Comment

Interaction

Transcription Rv3089

sourish10

NAS

Operon (Functional linkage)
A. Singh, S. Jain et al. mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. FEMS Microbiol. Lett. 2003

Citation

mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. A. Singh, S. Jain et al. FEMS Microbiol. Lett. 2003

sourish10

IEP

14568148

Co-expression (Functional linkage)

Interaction

Transcription Rv3082c

sourish10

IEP

Co-expression (Functional linkage)
A. Singh, S. Jain et al. mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. FEMS Microbiol. Lett. 2003

Citation

The Mycobacterium tuberculosis protein kinase K modulates activation of transcription from the promoter of mycobacterial monooxygenase operon through phosphorylation of the transcriptional regulator VirS. P. Kumar, D. Kumar et al. J. Biol. Chem. 2009

sourish10

IDA

19251699

Spectrophotometric

Interaction

Activation Rv3080c

sourish10

IDA

Spectrophotometric
P. Kumar, D. Kumar et al. The Mycobacterium tuberculosis protein kinase K modulates activation of transcription from the promoter of mycobacterial monooxygenase operon through phosphorylation of the transcriptional regulator VirS. J. Biol. Chem. 2009

Citation

sourish10

IDA

19251699

Structural Analysis

Interaction

Activation Rv3080c

sourish10

IDA

Structural Analysis
P. Kumar, D. Kumar et al. The Mycobacterium tuberculosis protein kinase K modulates activation of transcription from the promoter of mycobacterial monooxygenase operon through phosphorylation of the transcriptional regulator VirS. J. Biol. Chem. 2009

Citation

mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. A. Singh, S. Jain et al. FEMS Microbiol. Lett. 2003

sourish10

NAS

14568148

Operon (Functional linkage)

Interaction

Transcription Rv3083

sourish10

NAS

Operon (Functional linkage)
A. Singh, S. Jain et al. mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. FEMS Microbiol. Lett. 2003

Interaction

Transcription Rv3084

sourish10

NAS

Operon (Functional linkage)
A. Singh, S. Jain et al. mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. FEMS Microbiol. Lett. 2003

Interaction

Transcription Rv3086

sourish10

NAS

Operon (Functional linkage)
A. Singh, S. Jain et al. mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. FEMS Microbiol. Lett. 2003

Interaction

Transcription Rv3087

sourish10

NAS

Operon (Functional linkage)
A. Singh, S. Jain et al. mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. FEMS Microbiol. Lett. 2003

Interaction

Transcription Rv3085

sourish10

NAS

Operon (Functional linkage)
A. Singh, S. Jain et al. mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. FEMS Microbiol. Lett. 2003

Interaction

Transcription Rv3085

sourish10

IEP

Co-expression (Functional linkage)
A. Singh, S. Jain et al. mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. FEMS Microbiol. Lett. 2003

Interaction

Transcription Rv3084

sourish10

IEP

Co-expression (Functional linkage)
A. Singh, S. Jain et al. mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. FEMS Microbiol. Lett. 2003

Interaction

Transcription Rv3083

priyadarshinipriyanka2001

IEP

Co-expression (Functional linkage)
A. Singh, S. Jain et al. mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. FEMS Microbiol. Lett. 2003

Interaction

Transcription Rv3082c

priyadarshinipriyanka2001

IEP

Co-expression (Functional linkage)
A. Singh, S. Jain et al. mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. FEMS Microbiol. Lett. 2003

Interaction

Transcription Rv3082c

priyadarshinipriyanka2001

IEP

Co-expression (Functional linkage)
P. Kumar, D. Kumar et al. The Mycobacterium tuberculosis protein kinase K modulates activation of transcription from the promoter of mycobacterial monooxygenase operon through phosphorylation of the transcriptional regulator VirS. J. Biol. Chem. 2009

Interaction

Transcription Rv3082c

priyadarshinipriyanka2001

IEP

Co-expression (Functional linkage)
A. Singh, R. Gupta et al. Requirement of the mymA operon for appropriate cell wall ultrastructure and persistence of Mycobacterium tuberculosis in the spleens of guinea pigs. J. Bacteriol. 2005

Interaction

RegulatedBy Rv3082c

yamir.moreno

IEP

LacZ-promoter fusion. expression levels of LacZ- regulated promoter fusion measured and compared between wild-type and trans-element mutation (knockout, over expression etc.). Gfp-promoter fusion. expression levels of gfp-regulated promoter fusion measured and compared between wild-type and trans-element mutation (knockout, over expression etc.).
A. Singh, S. Jain et al. mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. FEMS Microbiol. Lett. 2003

Interaction

RegulatedBy Rv3082c

yamir.moreno

IEP

Symbol

tgs4

mjackson

IDA

Triglyceride biosynthesis

Name

Putative acyl CoA:diacylglycerol acyltransferase

mjackson

IDA

Triglyceride biosynthesis

Symbol

tgs4

mjackson

Putative acyl CoA:diacylglycerol acyltransferase (enzymatic)
J. Daniel, C. Deb et al. Induction of a novel class of diacylglycerol acyltransferases and triacylglycerol accumulation in Mycobacterium tuberculosis as it goes into a dormancy-like state in culture. J. Bacteriol. 2004

Citation

Induction of a novel class of diacylglycerol acyltransferases and triacylglycerol accumulation in Mycobacterium tuberculosis as it goes into a dormancy-like state in culture. J. Daniel, C. Deb et al. J. Bacteriol. 2004

mjackson

15262939

Putative acyl CoA:diacylglycerol acyltransferase (enzymatic)

Other

TBPWY:Triglyceride biosynthesis

mjackson

Comments