Rv3082c (virS)

Current annotations:
- TBCAP: (community-based annotations - see table at bottom of page)
- TBDB: araC/xylS-family virulence-regulating transcriptional regulator virS
- REFSEQ: virulence-regulating transcriptional regulator VirS
- PATRIC: Transcriptional regulator AraC family
- TUBERCULIST: Virulence-regulating transcriptional regulator VirS (AraC/XylS family)
- NCBI: Virulence-regulating transcriptional regulator VirS (AraC/XylS family)
- updated information (H37Rv4):
  - gene name: virS
  - function:
  - reference:
Type: Not Target
Start: 3447404
End: 3448426
Operon:

Trans-membrane region:
Role: I.J.1 - Repressors/activators
GO terms:
- GO:0071468 - cellular response to acidic pH (Uniprot)
- GO:0045893 - positive regulation of transcription, DNA-templated (Uniprot)
- GO:0043565 - sequence-specific DNA binding (Uniprot)
- GO:0019249 - lactate biosynthetic process (Uniprot)
- GO:0019243 - methylglyoxal catabolic process to D-lactate via S-lactoyl-glutathione (Uniprot)
- GO:0019172 - glyoxalase III activity (Uniprot)
- GO:0009405 - pathogenesis (Uniprot)
- GO:0006355 - regulation of transcription, DNA-templated (Uniprot)
- GO:0006351 - transcription, DNA-templated (Uniprot)
- GO:0005829 - cytosol (Uniprot)
- GO:0003700 - DNA binding transcription factor activity (Uniprot)
- GO:0003677 - DNA binding (Uniprot)
Reaction(s) (based on iSM810 metabolic model):
Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
Orthologs among selected mycobacteria
Protein structure:
Search for Homologs in PDB
Top 10 Homologs in PDB (as of Nov 2020): (none with >35% aa id)
Links to additional information on virS:
- TBDB (updated)
- Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
- UniProt
- AlphaFold model
- Vulnerability = 0.335 (from Jeremy Rock's lab)
- KEGG - nucleotide and amino acid sequences of gene
- Mycobrowser
- PATRIC
- BioCyc
- Systems Biology

Amino Acid Sequence

MELGSLIRATNLWGYTDLMRELGADPLPFLRRFDIPPGIEHQEDAFMSLAGFVRMLEASAAELDCPDFGLRLARWQGLGILGPVAVIARNAATLFGGLEA
IGRYLYVHSPALTLTVSSTTARSNVRFGYEVTEPGIPYPLQGYELSMANAARMIRLLGGPQARARVFSFRHAQLGTDAAYREALGCTVRFGRTWCGFEVD
HRLAGRPIDHADPETKRIATKYLESQYLPSDATLSERVVGLARRLLPTGQCSAEAIADQLDMHPRTLQRRLAAEGLRCHDLIERERRAQAARYLAQPGLY
LSQIAVLLGYSEQSALNRSCRRWFGMTPRQYRAYGGVSGR

(Nucleotide sequence available on KEGG)

Additional Information

ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across >100 conditions *new*

Classification	Condition	Strain	Method	Reference	Notes
Non-Essential	Sodium Oleate	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.000450; 6 non-insertions in a row out of 19 sites
Non-Essential	Lignoceric Acid	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.000000; 3 non-insertions in a row out of 19 sites
Non-Essential	Phosphatidylcholine	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.000000; 1 non-insertions in a row out of 19 sites
Non-Essential	minimal media + 0.1% glycerol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 0.000000; 3 non-insertions in a row out of 19 sites
Non-Essential	minimal media + 0.01% cholesterol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 0.000000; 3 non-insertions in a row out of 19 sites
Non-Essential	7H10-glycerol	H37RvMA	TraSH	Sassetti et al. (2003a)
Non-Essential	C57BL/6J mice (8 weeks)	H37RvMA	TraSH	Sassetti et al. (2003b)	Hybridization Ratio: 0.93
Non-Essential	7H09/7H10 + rich media	H37RvMA	MotifHMM	DeJesus et al. (2017)	Fully saturated (14 reps).

TnSeq Data No data currently available.

No TnSeq data currently available for this Target.

RNASeq Data No data currently available.

No RNA-Seq data currently available for this Target.

Metabolomic Profiles No data currently available.

No Metabolomic data currently available for this Target.

Proteomic Data No data currently available.

No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology

BioCyc

Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

Interactions based on ChIPSeq data

RNA processing and modification

Energy production and conversion

Chromatin structure and dynamics

Amino acid transport and metabolism

Cell cycle control, cell division, chromosome partitioning

Carbohydrate transport and metabolism

Nucleotide transport and metabolism

Lipid transport and metabolism

Coenzyme transport and metabolism

Transcription

Translation, ribosomal structure and biogenesis

Cell wall/membrane/envelope biogenesis

Replication, recombination and repair

Posttranslational modification, protein turnover, chaperones

Cell motility

Secondary metabolites biosynthesis, transport and catabolism

Inorganic ion transport and metabolism

Function unknown

General function prediction only

Intracellular trafficking, secretion, and vesicular transport

Signal transduction mechanisms

Extracellular structures

Defense mechanisms

Nuclear structure

Cytoskeleton

BioCyc Co-regulated genes based on gene expression profiling (Systems Biology, Inferelator Network)

Differentially expressed as result of RNASeq in glycerol environment (Only top 20 genes shown sorted by log fold change with p_adj 0.05).

Conditionally essential as result of TNSeq (Only top 20 genes shown sorted by log fold change with p_adj 0.05).

BioCyc Transcription factor binding based on ChIP-Seq (Systems Biology)

Binds To:
Bound By:
- No bindings from other targets were found.

Interactions based on ChIPSeq data (Minch et al. 2014)

Binds To:
- Rv3082c (virS) (Direct binding)
- Rv3083 (-) (Direct binding)
- Rv3084 (lipR) (Upstream of operon)
- Rv3085 (-) (Upstream of operon)
- Rv3086 (adhD) (Upstream of operon)
- Rv3087 (-) (Upstream of operon)
- Rv3088 (tgs4) (Upstream of operon)
- Rv3089 (fadD13) (Upstream of operon)
Bound By:
- Rv3082c (virS) (Direct binding)
- Rv3736 (-) (Direct binding)

Interactions based on TFOE data (Rustad et al. 2014)

Upregulates:
Upregulated by:
- Rv3082c (virS)
Downregulates:
Downregulated by:
- Not downregulated by other genes.

TBCAP

Tubculosis Community Annotation Project (

Slayden et al., 2013

Rv3082c (virS)

Property	Value	Creator	Evidence	PMID	Comment
Interaction	Transcription Rv3089	sourish10	IEP		Co-expression (Functional linkage) A. Singh, S. Jain et al. mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. FEMS Microbiol. Lett. 2003
Interaction	Transcription Rv3088	sourish10	IEP		Co-expression (Functional linkage) A. Singh, S. Jain et al. mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. FEMS Microbiol. Lett. 2003
Interaction	Transcription Rv3086	ilamathi.raja	NAS		Operon (Functional linkage) A. Singh, S. Jain et al. mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. FEMS Microbiol. Lett. 2003
Interaction	Transcription Rv3087	sourish10	IEP		Co-expression (Functional linkage) A. Singh, S. Jain et al. mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. FEMS Microbiol. Lett. 2003
Interaction	Transcription Rv3085	sourish10	IEP		Co-expression (Functional linkage) A. Singh, S. Jain et al. mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. FEMS Microbiol. Lett. 2003
Interaction	Transcription Rv3086	ilamathi.raja	NAS		Operon (Functional linkage) R. Singh, A. Singh et al. Deciphering the genes involved in pathogenesis of Mycobacterium tuberculosis. Tuberculosis (Edinburgh, Scotland) null
Interaction	Transcription Rv3084	sourish10	IEP		Co-expression (Functional linkage) A. Singh, S. Jain et al. mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. FEMS Microbiol. Lett. 2003
Interaction	Regulatory Rv3083	priyadarshinipriyanka2001	IEP		Co-expression (Functional linkage) A. Singh, S. Jain et al. mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. FEMS Microbiol. Lett. 2003
Interaction	Transcription Rv3083	priyadarshinipriyanka2001	IEP		Co-expression (Functional linkage) A. Singh, S. Jain et al. mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. FEMS Microbiol. Lett. 2003
Interaction	Transcription Rv3084	priyadarshinipriyanka2001	IEP		Co-expression (Functional linkage) A. Singh, S. Jain et al. mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. FEMS Microbiol. Lett. 2003
Interaction	Transcription Rv3085	priyadarshinipriyanka2001	IEP		Co-expression (Functional linkage) A. Singh, S. Jain et al. mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. FEMS Microbiol. Lett. 2003
Interaction	Transcription Rv3086	priyadarshinipriyanka2001	IEP		Co-expression (Functional linkage) A. Singh, S. Jain et al. mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. FEMS Microbiol. Lett. 2003
Interaction	Transcription Rv3087	priyadarshinipriyanka2001	IEP		Co-expression (Functional linkage) A. Singh, S. Jain et al. mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. FEMS Microbiol. Lett. 2003
Interaction	Transcription Rv3088	priyadarshinipriyanka2001	IEP		Co-expression (Functional linkage) A. Singh, S. Jain et al. mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. FEMS Microbiol. Lett. 2003
Interaction	Transcription Rv3089	priyadarshinipriyanka2001	IEP		Co-expression (Functional linkage) A. Singh, S. Jain et al. mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. FEMS Microbiol. Lett. 2003
Interaction	Transcription Rv3085	priyadarshinipriyanka2001	IEP		Co-expression (Functional linkage) P. Kumar, D. Kumar et al. The Mycobacterium tuberculosis protein kinase K modulates activation of transcription from the promoter of mycobacterial monooxygenase operon through phosphorylation of the transcriptional regulator VirS. J. Biol. Chem. 2009
Interaction	Transcription Rv3086	priyadarshinipriyanka2001	IEP		Co-expression (Functional linkage) P. Kumar, D. Kumar et al. The Mycobacterium tuberculosis protein kinase K modulates activation of transcription from the promoter of mycobacterial monooxygenase operon through phosphorylation of the transcriptional regulator VirS. J. Biol. Chem. 2009
Interaction	Transcription Rv3087	priyadarshinipriyanka2001	IEP		Co-expression (Functional linkage) P. Kumar, D. Kumar et al. The Mycobacterium tuberculosis protein kinase K modulates activation of transcription from the promoter of mycobacterial monooxygenase operon through phosphorylation of the transcriptional regulator VirS. J. Biol. Chem. 2009
Interaction	Transcription Rv3088	priyadarshinipriyanka2001	IEP		Co-expression (Functional linkage) P. Kumar, D. Kumar et al. The Mycobacterium tuberculosis protein kinase K modulates activation of transcription from the promoter of mycobacterial monooxygenase operon through phosphorylation of the transcriptional regulator VirS. J. Biol. Chem. 2009
Interaction	Transcription Rv3089	priyadarshinipriyanka2001	IEP		Co-expression (Functional linkage) P. Kumar, D. Kumar et al. The Mycobacterium tuberculosis protein kinase K modulates activation of transcription from the promoter of mycobacterial monooxygenase operon through phosphorylation of the transcriptional regulator VirS. J. Biol. Chem. 2009
Citation	mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. A. Singh, S. Jain et al. FEMS Microbiol. Lett. 2003	priyadarshinipriyanka2001	IEP	14568148	Co-expression (Functional linkage)
Interaction	Transcription Rv3086	priyadarshinipriyanka2001	IEP		Co-expression (Functional linkage) A. Singh, R. Gupta et al. Requirement of the mymA operon for appropriate cell wall ultrastructure and persistence of Mycobacterium tuberculosis in the spleens of guinea pigs. J. Bacteriol. 2005
Interaction	Transcription Rv3087	priyadarshinipriyanka2001	IEP		Co-expression (Functional linkage) A. Singh, R. Gupta et al. Requirement of the mymA operon for appropriate cell wall ultrastructure and persistence of Mycobacterium tuberculosis in the spleens of guinea pigs. J. Bacteriol. 2005
Interaction	Transcription Rv3088	priyadarshinipriyanka2001	IEP		Co-expression (Functional linkage) A. Singh, R. Gupta et al. Requirement of the mymA operon for appropriate cell wall ultrastructure and persistence of Mycobacterium tuberculosis in the spleens of guinea pigs. J. Bacteriol. 2005
Interaction	Transcription Rv3089	priyadarshinipriyanka2001	IEP		Co-expression (Functional linkage) A. Singh, R. Gupta et al. Requirement of the mymA operon for appropriate cell wall ultrastructure and persistence of Mycobacterium tuberculosis in the spleens of guinea pigs. J. Bacteriol. 2005
Citation	The Mycobacterium tuberculosis protein kinase K modulates activation of transcription from the promoter of mycobacterial monooxygenase operon through phosphorylation of the transcriptional regulator VirS. P. Kumar, D. Kumar et al. J. Biol. Chem. 2009	priyadarshinipriyanka2001	IEP	19251699	Co-expression (Functional linkage)
Interaction	Transcription Rv3083	priyadarshinipriyanka2001	IEP		Co-expression (Functional linkage) P. Kumar, D. Kumar et al. The Mycobacterium tuberculosis protein kinase K modulates activation of transcription from the promoter of mycobacterial monooxygenase operon through phosphorylation of the transcriptional regulator VirS. J. Biol. Chem. 2009
Interaction	Transcription Rv3084	priyadarshinipriyanka2001	IEP		Co-expression (Functional linkage) P. Kumar, D. Kumar et al. The Mycobacterium tuberculosis protein kinase K modulates activation of transcription from the promoter of mycobacterial monooxygenase operon through phosphorylation of the transcriptional regulator VirS. J. Biol. Chem. 2009
Citation	Requirement of the mymA operon for appropriate cell wall ultrastructure and persistence of Mycobacterium tuberculosis in the spleens of guinea pigs. A. Singh, R. Gupta et al. J. Bacteriol. 2005	priyadarshinipriyanka2001	IEP	15937179	Co-expression (Functional linkage)
Interaction	Transcription Rv3083	priyadarshinipriyanka2001	IEP		Co-expression (Functional linkage) A. Singh, R. Gupta et al. Requirement of the mymA operon for appropriate cell wall ultrastructure and persistence of Mycobacterium tuberculosis in the spleens of guinea pigs. J. Bacteriol. 2005
Interaction	Transcription Rv3084	priyadarshinipriyanka2001	IEP		Co-expression (Functional linkage) A. Singh, R. Gupta et al. Requirement of the mymA operon for appropriate cell wall ultrastructure and persistence of Mycobacterium tuberculosis in the spleens of guinea pigs. J. Bacteriol. 2005
Interaction	Transcription Rv3085	priyadarshinipriyanka2001	IEP		Co-expression (Functional linkage) A. Singh, R. Gupta et al. Requirement of the mymA operon for appropriate cell wall ultrastructure and persistence of Mycobacterium tuberculosis in the spleens of guinea pigs. J. Bacteriol. 2005
Interaction	RegulatedBy Rv3082c	yamir.moreno	IEP		LacZ-promoter fusion. expression levels of LacZ- regulated promoter fusion measured and compared between wild-type and trans-element mutation (knockout, over expression etc.). Gfp-promoter fusion. expression levels of gfp-regulated promoter fusion measured and compared between wild-type and trans-element mutation (knockout, over expression etc.). A. Singh, S. Jain et al. mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. FEMS Microbiol. Lett. 2003
Citation	mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. A. Singh, S. Jain et al. FEMS Microbiol. Lett. 2003	yamir.moreno	IEP	14568148	LacZ-promoter fusion. expression levels of LacZ- regulated promoter fusion measured and compared between wild-type and trans-element mutation (knockout, over expression etc.). Gfp-promoter fusion. expression levels of gfp-regulated promoter fusion measured and compared between wild-type and trans-element mutation (knockout, over expression etc.).
Interaction	Regulates Rv3089	yamir.moreno	IEP		LacZ-promoter fusion. expression levels of LacZ- regulated promoter fusion measured and compared between wild-type and trans-element mutation (knockout, over expression etc.). Gfp-promoter fusion. expression levels of gfp-regulated promoter fusion measured and compared between wild-type and trans-element mutation (knockout, over expression etc.). A. Singh, S. Jain et al. mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. FEMS Microbiol. Lett. 2003
Citation	mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. A. Singh, S. Jain et al. FEMS Microbiol. Lett. 2003	yamir.moreno	IEP	14568148	LacZ-promoter fusion. expression levels of LacZ- regulated promoter fusion measured and compared between wild-type and trans-element mutation (knockout, over expression etc.). Gfp-promoter fusion. expression levels of gfp-regulated promoter fusion measured and compared between wild-type and trans-element mutation (knockout, over expression etc.).
Interaction	Regulates Rv3082c	yamir.moreno	IEP		LacZ-promoter fusion. expression levels of LacZ- regulated promoter fusion measured and compared between wild-type and trans-element mutation (knockout, over expression etc.). Gfp-promoter fusion. expression levels of gfp-regulated promoter fusion measured and compared between wild-type and trans-element mutation (knockout, over expression etc.). A. Singh, S. Jain et al. mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. FEMS Microbiol. Lett. 2003
Interaction	RegulatedBy Rv3082c	yamir.moreno	IEP		LacZ-promoter fusion. expression levels of LacZ- regulated promoter fusion measured and compared between wild-type and trans-element mutation (knockout, over expression etc.). Gfp-promoter fusion. expression levels of gfp-regulated promoter fusion measured and compared between wild-type and trans-element mutation (knockout, over expression etc.). A. Singh, S. Jain et al. mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. FEMS Microbiol. Lett. 2003
Citation	mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. A. Singh, S. Jain et al. FEMS Microbiol. Lett. 2003	yamir.moreno	IEP	14568148	LacZ-promoter fusion. expression levels of LacZ- regulated promoter fusion measured and compared between wild-type and trans-element mutation (knockout, over expression etc.). Gfp-promoter fusion. expression levels of gfp-regulated promoter fusion measured and compared between wild-type and trans-element mutation (knockout, over expression etc.).
Interaction	Regulates Rv3082c	yamir.moreno	IEP		LacZ-promoter fusion. expression levels of LacZ- regulated promoter fusion measured and compared between wild-type and trans-element mutation (knockout, over expression etc.). Gfp-promoter fusion. expression levels of gfp-regulated promoter fusion measured and compared between wild-type and trans-element mutation (knockout, over expression etc.). A. Singh, S. Jain et al. mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. FEMS Microbiol. Lett. 2003
Citation	mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. A. Singh, S. Jain et al. FEMS Microbiol. Lett. 2003	yamir.moreno	IEP	14568148	LacZ-promoter fusion. expression levels of LacZ- regulated promoter fusion measured and compared between wild-type and trans-element mutation (knockout, over expression etc.). Gfp-promoter fusion. expression levels of gfp-regulated promoter fusion measured and compared between wild-type and trans-element mutation (knockout, over expression etc.).
Interaction	Regulates Rv3088	yamir.moreno	IEP		LacZ-promoter fusion. expression levels of LacZ- regulated promoter fusion measured and compared between wild-type and trans-element mutation (knockout, over expression etc.). Gfp-promoter fusion. expression levels of gfp-regulated promoter fusion measured and compared between wild-type and trans-element mutation (knockout, over expression etc.). A. Singh, S. Jain et al. mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. FEMS Microbiol. Lett. 2003
Citation	mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. A. Singh, S. Jain et al. FEMS Microbiol. Lett. 2003	yamir.moreno	IEP	14568148	LacZ-promoter fusion. expression levels of LacZ- regulated promoter fusion measured and compared between wild-type and trans-element mutation (knockout, over expression etc.). Gfp-promoter fusion. expression levels of gfp-regulated promoter fusion measured and compared between wild-type and trans-element mutation (knockout, over expression etc.).
Interaction	Regulates Rv3088	yamir.moreno	IEP		LacZ-promoter fusion. expression levels of LacZ- regulated promoter fusion measured and compared between wild-type and trans-element mutation (knockout, over expression etc.). Gfp-promoter fusion. expression levels of gfp-regulated promoter fusion measured and compared between wild-type and trans-element mutation (knockout, over expression etc.). A. Singh, S. Jain et al. mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. FEMS Microbiol. Lett. 2003
Citation	mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. A. Singh, S. Jain et al. FEMS Microbiol. Lett. 2003	yamir.moreno	IEP	14568148	LacZ-promoter fusion. expression levels of LacZ- regulated promoter fusion measured and compared between wild-type and trans-element mutation (knockout, over expression etc.). Gfp-promoter fusion. expression levels of gfp-regulated promoter fusion measured and compared between wild-type and trans-element mutation (knockout, over expression etc.).
Interaction	Regulates Rv3089	yamir.moreno	IEP		LacZ-promoter fusion. expression levels of LacZ- regulated promoter fusion measured and compared between wild-type and trans-element mutation (knockout, over expression etc.). Gfp-promoter fusion. expression levels of gfp-regulated promoter fusion measured and compared between wild-type and trans-element mutation (knockout, over expression etc.). A. Singh, S. Jain et al. mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. FEMS Microbiol. Lett. 2003
Citation	mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. A. Singh, S. Jain et al. FEMS Microbiol. Lett. 2003	yamir.moreno	IEP	14568148	LacZ-promoter fusion. expression levels of LacZ- regulated promoter fusion measured and compared between wild-type and trans-element mutation (knockout, over expression etc.). Gfp-promoter fusion. expression levels of gfp-regulated promoter fusion measured and compared between wild-type and trans-element mutation (knockout, over expression etc.).
Interaction	Regulates Rv3086	yamir.moreno	IEP		LacZ-promoter fusion. expression levels of LacZ- regulated promoter fusion measured and compared between wild-type and trans-element mutation (knockout, over expression etc.). Gfp-promoter fusion. expression levels of gfp-regulated promoter fusion measured and compared between wild-type and trans-element mutation (knockout, over expression etc.). A. Singh, S. Jain et al. mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. FEMS Microbiol. Lett. 2003
Citation	mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. A. Singh, S. Jain et al. FEMS Microbiol. Lett. 2003	yamir.moreno	IEP	14568148	LacZ-promoter fusion. expression levels of LacZ- regulated promoter fusion measured and compared between wild-type and trans-element mutation (knockout, over expression etc.). Gfp-promoter fusion. expression levels of gfp-regulated promoter fusion measured and compared between wild-type and trans-element mutation (knockout, over expression etc.).
Interaction	Regulates Rv3087	yamir.moreno	IEP		LacZ-promoter fusion. expression levels of LacZ- regulated promoter fusion measured and compared between wild-type and trans-element mutation (knockout, over expression etc.). Gfp-promoter fusion. expression levels of gfp-regulated promoter fusion measured and compared between wild-type and trans-element mutation (knockout, over expression etc.). A. Singh, S. Jain et al. mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. FEMS Microbiol. Lett. 2003
Citation	mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. A. Singh, S. Jain et al. FEMS Microbiol. Lett. 2003	yamir.moreno	IEP	14568148	LacZ-promoter fusion. expression levels of LacZ- regulated promoter fusion measured and compared between wild-type and trans-element mutation (knockout, over expression etc.). Gfp-promoter fusion. expression levels of gfp-regulated promoter fusion measured and compared between wild-type and trans-element mutation (knockout, over expression etc.).
Interaction	Regulates Rv3087	yamir.moreno	IEP		LacZ-promoter fusion. expression levels of LacZ- regulated promoter fusion measured and compared between wild-type and trans-element mutation (knockout, over expression etc.). Gfp-promoter fusion. expression levels of gfp-regulated promoter fusion measured and compared between wild-type and trans-element mutation (knockout, over expression etc.). A. Singh, S. Jain et al. mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. FEMS Microbiol. Lett. 2003
Citation	mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. A. Singh, S. Jain et al. FEMS Microbiol. Lett. 2003	yamir.moreno	IEP	14568148	LacZ-promoter fusion. expression levels of LacZ- regulated promoter fusion measured and compared between wild-type and trans-element mutation (knockout, over expression etc.). Gfp-promoter fusion. expression levels of gfp-regulated promoter fusion measured and compared between wild-type and trans-element mutation (knockout, over expression etc.).
Interaction	Regulates Rv3085	yamir.moreno	IEP		LacZ-promoter fusion. expression levels of LacZ- regulated promoter fusion measured and compared between wild-type and trans-element mutation (knockout, over expression etc.). Gfp-promoter fusion. expression levels of gfp-regulated promoter fusion measured and compared between wild-type and trans-element mutation (knockout, over expression etc.). A. Singh, S. Jain et al. mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. FEMS Microbiol. Lett. 2003
Citation	mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. A. Singh, S. Jain et al. FEMS Microbiol. Lett. 2003	yamir.moreno	IEP	14568148	LacZ-promoter fusion. expression levels of LacZ- regulated promoter fusion measured and compared between wild-type and trans-element mutation (knockout, over expression etc.). Gfp-promoter fusion. expression levels of gfp-regulated promoter fusion measured and compared between wild-type and trans-element mutation (knockout, over expression etc.).
Interaction	Regulates Rv3085	yamir.moreno	IEP		LacZ-promoter fusion. expression levels of LacZ- regulated promoter fusion measured and compared between wild-type and trans-element mutation (knockout, over expression etc.). Gfp-promoter fusion. expression levels of gfp-regulated promoter fusion measured and compared between wild-type and trans-element mutation (knockout, over expression etc.). A. Singh, S. Jain et al. mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. FEMS Microbiol. Lett. 2003
Citation	mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. A. Singh, S. Jain et al. FEMS Microbiol. Lett. 2003	yamir.moreno	IEP	14568148	LacZ-promoter fusion. expression levels of LacZ- regulated promoter fusion measured and compared between wild-type and trans-element mutation (knockout, over expression etc.). Gfp-promoter fusion. expression levels of gfp-regulated promoter fusion measured and compared between wild-type and trans-element mutation (knockout, over expression etc.).
Interaction	Regulates Rv3086	yamir.moreno	IEP		LacZ-promoter fusion. expression levels of LacZ- regulated promoter fusion measured and compared between wild-type and trans-element mutation (knockout, over expression etc.). Gfp-promoter fusion. expression levels of gfp-regulated promoter fusion measured and compared between wild-type and trans-element mutation (knockout, over expression etc.). A. Singh, S. Jain et al. mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. FEMS Microbiol. Lett. 2003
Citation	mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. A. Singh, S. Jain et al. FEMS Microbiol. Lett. 2003	yamir.moreno	IEP	14568148	LacZ-promoter fusion. expression levels of LacZ- regulated promoter fusion measured and compared between wild-type and trans-element mutation (knockout, over expression etc.). Gfp-promoter fusion. expression levels of gfp-regulated promoter fusion measured and compared between wild-type and trans-element mutation (knockout, over expression etc.).
Interaction	Regulates Rv3083	yamir.moreno	IEP		LacZ-promoter fusion. expression levels of LacZ- regulated promoter fusion measured and compared between wild-type and trans-element mutation (knockout, over expression etc.). Gfp-promoter fusion. expression levels of gfp-regulated promoter fusion measured and compared between wild-type and trans-element mutation (knockout, over expression etc.). A. Singh, S. Jain et al. mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. FEMS Microbiol. Lett. 2003
Citation	mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. A. Singh, S. Jain et al. FEMS Microbiol. Lett. 2003	yamir.moreno	IEP	14568148	LacZ-promoter fusion. expression levels of LacZ- regulated promoter fusion measured and compared between wild-type and trans-element mutation (knockout, over expression etc.). Gfp-promoter fusion. expression levels of gfp-regulated promoter fusion measured and compared between wild-type and trans-element mutation (knockout, over expression etc.).
Interaction	Regulates Rv3084	yamir.moreno	IEP		LacZ-promoter fusion. expression levels of LacZ- regulated promoter fusion measured and compared between wild-type and trans-element mutation (knockout, over expression etc.). Gfp-promoter fusion. expression levels of gfp-regulated promoter fusion measured and compared between wild-type and trans-element mutation (knockout, over expression etc.). A. Singh, S. Jain et al. mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. FEMS Microbiol. Lett. 2003
Citation	mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. A. Singh, S. Jain et al. FEMS Microbiol. Lett. 2003	yamir.moreno	IEP	14568148	LacZ-promoter fusion. expression levels of LacZ- regulated promoter fusion measured and compared between wild-type and trans-element mutation (knockout, over expression etc.). Gfp-promoter fusion. expression levels of gfp-regulated promoter fusion measured and compared between wild-type and trans-element mutation (knockout, over expression etc.).
Interaction	Regulates Rv3084	yamir.moreno	IEP		LacZ-promoter fusion. expression levels of LacZ- regulated promoter fusion measured and compared between wild-type and trans-element mutation (knockout, over expression etc.). Gfp-promoter fusion. expression levels of gfp-regulated promoter fusion measured and compared between wild-type and trans-element mutation (knockout, over expression etc.). A. Singh, S. Jain et al. mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. FEMS Microbiol. Lett. 2003
Citation	mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. A. Singh, S. Jain et al. FEMS Microbiol. Lett. 2003	yamir.moreno	IEP	14568148	LacZ-promoter fusion. expression levels of LacZ- regulated promoter fusion measured and compared between wild-type and trans-element mutation (knockout, over expression etc.). Gfp-promoter fusion. expression levels of gfp-regulated promoter fusion measured and compared between wild-type and trans-element mutation (knockout, over expression etc.).
Interaction	Regulates Rv3083	yamir.moreno	IEP		LacZ-promoter fusion. expression levels of LacZ- regulated promoter fusion measured and compared between wild-type and trans-element mutation (knockout, over expression etc.). Gfp-promoter fusion. expression levels of gfp-regulated promoter fusion measured and compared between wild-type and trans-element mutation (knockout, over expression etc.). A. Singh, S. Jain et al. mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. FEMS Microbiol. Lett. 2003

Property

Value

Creator

Evidence

PMID

Comment

Interaction

Transcription Rv3089

sourish10

IEP

Co-expression (Functional linkage)
A. Singh, S. Jain et al. mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. FEMS Microbiol. Lett. 2003

Interaction

Transcription Rv3088

sourish10

IEP

Co-expression (Functional linkage)
A. Singh, S. Jain et al. mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. FEMS Microbiol. Lett. 2003

Interaction

Transcription Rv3086

ilamathi.raja

NAS

Operon (Functional linkage)
A. Singh, S. Jain et al. mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. FEMS Microbiol. Lett. 2003

Interaction

Transcription Rv3087

sourish10

IEP

Co-expression (Functional linkage)
A. Singh, S. Jain et al. mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. FEMS Microbiol. Lett. 2003

Interaction

Transcription Rv3085

sourish10

IEP

Co-expression (Functional linkage)
A. Singh, S. Jain et al. mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. FEMS Microbiol. Lett. 2003

Interaction

Transcription Rv3086

ilamathi.raja

NAS

Operon (Functional linkage)
R. Singh, A. Singh et al. Deciphering the genes involved in pathogenesis of Mycobacterium tuberculosis. Tuberculosis (Edinburgh, Scotland) null

Interaction

Transcription Rv3084

sourish10

IEP

Co-expression (Functional linkage)
A. Singh, S. Jain et al. mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. FEMS Microbiol. Lett. 2003

Interaction

Regulatory Rv3083

priyadarshinipriyanka2001

IEP

Co-expression (Functional linkage)
A. Singh, S. Jain et al. mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. FEMS Microbiol. Lett. 2003

Interaction

Transcription Rv3083

priyadarshinipriyanka2001

IEP

Co-expression (Functional linkage)
A. Singh, S. Jain et al. mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. FEMS Microbiol. Lett. 2003

Interaction

Transcription Rv3084

priyadarshinipriyanka2001

IEP

Co-expression (Functional linkage)
A. Singh, S. Jain et al. mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. FEMS Microbiol. Lett. 2003

Interaction

Transcription Rv3085

priyadarshinipriyanka2001

IEP

Co-expression (Functional linkage)
A. Singh, S. Jain et al. mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. FEMS Microbiol. Lett. 2003

Interaction

Transcription Rv3086

priyadarshinipriyanka2001

IEP

Co-expression (Functional linkage)
A. Singh, S. Jain et al. mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. FEMS Microbiol. Lett. 2003

Interaction

Transcription Rv3087

priyadarshinipriyanka2001

IEP

Co-expression (Functional linkage)
A. Singh, S. Jain et al. mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. FEMS Microbiol. Lett. 2003

Interaction

Transcription Rv3088

priyadarshinipriyanka2001

IEP

Co-expression (Functional linkage)
A. Singh, S. Jain et al. mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. FEMS Microbiol. Lett. 2003

Interaction

Transcription Rv3089

priyadarshinipriyanka2001

IEP

Co-expression (Functional linkage)
A. Singh, S. Jain et al. mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. FEMS Microbiol. Lett. 2003

Interaction

Transcription Rv3085

priyadarshinipriyanka2001

IEP

Co-expression (Functional linkage)
P. Kumar, D. Kumar et al. The Mycobacterium tuberculosis protein kinase K modulates activation of transcription from the promoter of mycobacterial monooxygenase operon through phosphorylation of the transcriptional regulator VirS. J. Biol. Chem. 2009

Interaction

Transcription Rv3086

priyadarshinipriyanka2001

IEP

Interaction

Transcription Rv3087

priyadarshinipriyanka2001

IEP

Interaction

Transcription Rv3088

priyadarshinipriyanka2001

IEP

Interaction

Transcription Rv3089

priyadarshinipriyanka2001

IEP

Citation

mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. A. Singh, S. Jain et al. FEMS Microbiol. Lett. 2003

priyadarshinipriyanka2001

IEP

14568148

Co-expression (Functional linkage)

Interaction

Transcription Rv3086

priyadarshinipriyanka2001

IEP

Co-expression (Functional linkage)
A. Singh, R. Gupta et al. Requirement of the mymA operon for appropriate cell wall ultrastructure and persistence of Mycobacterium tuberculosis in the spleens of guinea pigs. J. Bacteriol. 2005

Interaction

Transcription Rv3087

priyadarshinipriyanka2001

IEP

Interaction

Transcription Rv3088

priyadarshinipriyanka2001

IEP

Interaction

Transcription Rv3089

priyadarshinipriyanka2001

IEP

Citation

The Mycobacterium tuberculosis protein kinase K modulates activation of transcription from the promoter of mycobacterial monooxygenase operon through phosphorylation of the transcriptional regulator VirS. P. Kumar, D. Kumar et al. J. Biol. Chem. 2009

priyadarshinipriyanka2001

IEP

19251699

Co-expression (Functional linkage)

Interaction

Transcription Rv3083

priyadarshinipriyanka2001

IEP

Interaction

Transcription Rv3084

priyadarshinipriyanka2001

IEP

Citation

Requirement of the mymA operon for appropriate cell wall ultrastructure and persistence of Mycobacterium tuberculosis in the spleens of guinea pigs. A. Singh, R. Gupta et al. J. Bacteriol. 2005

priyadarshinipriyanka2001

IEP

15937179

Co-expression (Functional linkage)

Interaction

Transcription Rv3083

priyadarshinipriyanka2001

IEP

Interaction

Transcription Rv3084

priyadarshinipriyanka2001

IEP

Interaction

Transcription Rv3085

priyadarshinipriyanka2001

IEP

Interaction

RegulatedBy Rv3082c

yamir.moreno

IEP

LacZ-promoter fusion. expression levels of LacZ- regulated promoter fusion measured and compared between wild-type and trans-element mutation (knockout, over expression etc.). Gfp-promoter fusion. expression levels of gfp-regulated promoter fusion measured and compared between wild-type and trans-element mutation (knockout, over expression etc.).
A. Singh, S. Jain et al. mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. FEMS Microbiol. Lett. 2003

Citation

mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. A. Singh, S. Jain et al. FEMS Microbiol. Lett. 2003

yamir.moreno

IEP

14568148

Interaction

Regulates Rv3089

yamir.moreno

IEP

Citation

mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. A. Singh, S. Jain et al. FEMS Microbiol. Lett. 2003

yamir.moreno

IEP

14568148

Interaction

Regulates Rv3082c

yamir.moreno

IEP

Interaction

RegulatedBy Rv3082c

yamir.moreno

IEP

Citation

mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. A. Singh, S. Jain et al. FEMS Microbiol. Lett. 2003

yamir.moreno

IEP

14568148

Interaction

Regulates Rv3082c

yamir.moreno

IEP

Citation

mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. A. Singh, S. Jain et al. FEMS Microbiol. Lett. 2003

yamir.moreno

IEP

14568148

Interaction

Regulates Rv3088

yamir.moreno

IEP

Citation

mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. A. Singh, S. Jain et al. FEMS Microbiol. Lett. 2003

yamir.moreno

IEP

14568148

Interaction

Regulates Rv3088

yamir.moreno

IEP

Citation

mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. A. Singh, S. Jain et al. FEMS Microbiol. Lett. 2003

yamir.moreno

IEP

14568148

Interaction

Regulates Rv3089

yamir.moreno

IEP

Citation

mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. A. Singh, S. Jain et al. FEMS Microbiol. Lett. 2003

yamir.moreno

IEP

14568148

Interaction

Regulates Rv3086

yamir.moreno

IEP

Citation

mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. A. Singh, S. Jain et al. FEMS Microbiol. Lett. 2003

yamir.moreno

IEP

14568148

Interaction

Regulates Rv3087

yamir.moreno

IEP

Citation

mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. A. Singh, S. Jain et al. FEMS Microbiol. Lett. 2003

yamir.moreno

IEP

14568148

Interaction

Regulates Rv3087

yamir.moreno

IEP

Citation

mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. A. Singh, S. Jain et al. FEMS Microbiol. Lett. 2003

yamir.moreno

IEP

14568148

Interaction

Regulates Rv3085

yamir.moreno

IEP

Citation

mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. A. Singh, S. Jain et al. FEMS Microbiol. Lett. 2003

yamir.moreno

IEP

14568148

Interaction

Regulates Rv3085

yamir.moreno

IEP

Citation

mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. A. Singh, S. Jain et al. FEMS Microbiol. Lett. 2003

yamir.moreno

IEP

14568148

Interaction

Regulates Rv3086

yamir.moreno

IEP

Citation

mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. A. Singh, S. Jain et al. FEMS Microbiol. Lett. 2003

yamir.moreno

IEP

14568148

Interaction

Regulates Rv3083

yamir.moreno

IEP

Citation

mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. A. Singh, S. Jain et al. FEMS Microbiol. Lett. 2003

yamir.moreno

IEP

14568148

Interaction

Regulates Rv3084

yamir.moreno

IEP

Citation

mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. A. Singh, S. Jain et al. FEMS Microbiol. Lett. 2003

yamir.moreno

IEP

14568148

Interaction

Regulates Rv3084

yamir.moreno

IEP

Citation

mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. A. Singh, S. Jain et al. FEMS Microbiol. Lett. 2003

yamir.moreno

IEP

14568148

Interaction

Regulates Rv3083

yamir.moreno

IEP

Comments