TB Genome Annotation Portal

Rv3080c (pknK)

Amino Acid Sequence

MTDVDPHATRRDLVPNIPAELLEAGFDNVEEIGRGGFGVVYRCVQPSLDRAVAVKVLSTDLDRDNLERFLREQRAMGRLSGHPHIVTVLQVGVLAGGRPF
IVMPYHAKNSLETLIRRHGPLDWRETLSIGVKLAGALEAAHRVGTLHRDVKPGNILLTDYGEPQLTDFGIARIAGGFETATGVIAGSPAFTAPEVLEGAS
PTPASDVYSLGATLFCALTGHAAYERRSGERVIAQFLRITSQPIPDLRKQGLPADVAAAIERAMARHPADRPATAADVGEELRDVQRRNGVSVDEMPLPV
ELGVERRRSPEAHAAHRHTGGGTPTVPTPPTPATKYRPSVPTGSLVTRSRLTDILRAGGRRRLILIHAPSGFGKSTLAAQWREELSRDGAAVAWLTIDND
DNNEVWFLSHLLESIRRVRPTLAESLGHVLEEHGDDAGRYVLTSLIDEIHENDDRIAVVIDDWHRVSDSRTQAALGFLLDNGCHHLQLIVTSWSRAGLPV
GRLRIGDELAEIDSAALRFDTDEAAALLNDAGGLRLPRADVQALTTSTDGWAAALRLAALSLRGGGDATQLLRGLSGASDVIHEFLSENVLDTLEPELRE
FLLVASVTERTCGGLASALAGITNGRAMLEEAEHRGLFLQRTEDDPNWFRFHQMFADFLHRRLERGGSHRVAELHRRASAWFAENGYLHEAVDHALAAGD
PARAVDLVEQDETNLPEQSKMTTLLAIVQKLPTSMVVSRARLQLAIAWANILLQRPAPATGALNRFETALGRAELPEATQADLRAEADVLRAVAEVFADR
VERVDDLLAEAMSRPDTLPPRVPGTAGNTAALAAICRFEFAEVYPLLDWAAPYQEMMGPFGTVYAQCLRGMAARNRLDIVAALQNFRTAFEVGTAVGAHS
HAARLAGSLLAELLYETGDLAGAGRLMDESYLLGSEGGAVDYLAARYVIGARVKAAQGDHEGAADRLSTGGDTAVQLGLPRLAARINNERIRLGIALPAA
VAADLLAPRTIPRDNGIATMTAELDEDSAVRLLSAGDSADRDQACQRAGALAAAIDGTRRPLAALQAQILHIETLAATGRESDARNELAPVATKCAELGL
SRLLVDAGLA
(Nucleotide sequence available on KEGG)

Additional Information



ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across >100 conditions *new*

Classification Condition Strain Method Reference Notes
Uncertain Sodium Oleate H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: 0.283600;
6 non-insertions in a row out of 32 sites
Uncertain Lignoceric Acid H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: 0.586650;
6 non-insertions in a row out of 32 sites
Uncertain Phosphatidylcholine H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: 0.647950;
6 non-insertions in a row out of 32 sites
Non-Essential minimal media + 0.1% glycerol H37RvMA Gumbel Griffin et al. (2011) Probability of Essentiality: 0.000000;
2 non-insertions in a row out of 33 sites
Uncertain minimal media + 0.01% cholesterol H37RvMA Gumbel Griffin et al. (2011) Probability of Essentiality: 0.016800;
2 non-insertions in a row out of 33 sites
No-Data 7H10-glycerol H37RvMA TraSH Sassetti et al. (2003a)
Too-Short C57BL/6J mice (8 weeks) H37RvMA TraSH Sassetti et al. (2003b) Hybridization Ratio: -1
Non-Essential 7H09/7H10 + rich media H37RvMA MotifHMM DeJesus et al. (2017) Fully saturated (14 reps).

TnSeq Data No data currently available.
  • No TnSeq data currently available for this Target.
RNASeq Data No data currently available.
  • No RNA-Seq data currently available for this Target.
Metabolomic Profiles No data currently available.
  • No Metabolomic data currently available for this Target.
Proteomic Data No data currently available.
  • No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology
  • BioCyc

    Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

    NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

    Interactions based on ChIPSeq data

  • Interactions based on ChIPSeq data (Minch et al. 2014)

    • Binds To:

      • No bindings to other targets were found.
    • Bound By:

      • No bindings to other targets were found.

    Interactions based on TFOE data (Rustad et al. 2014)



    TBCAP

    Tubculosis Community Annotation Project (
    Slayden et al., 2013)

    Rv3080c (pknK)

    PropertyValueCreatorEvidencePMIDComment
    InteractionActivation Rv3088sourish10IDASpectrophotometric
    P. Kumar, D. Kumar et al. The Mycobacterium tuberculosis protein kinase K modulates activation of transcription from the promoter of mycobacterial monooxygenase operon through phosphorylation of the transcriptional regulator VirS. J. Biol. Chem. 2009
    InteractionActivation Rv3088sourish10IDAStructural Analysis
    P. Kumar, D. Kumar et al. The Mycobacterium tuberculosis protein kinase K modulates activation of transcription from the promoter of mycobacterial monooxygenase operon through phosphorylation of the transcriptional regulator VirS. J. Biol. Chem. 2009
    InteractionActivation Rv3085sourish10IDASpectrophotometric
    P. Kumar, D. Kumar et al. The Mycobacterium tuberculosis protein kinase K modulates activation of transcription from the promoter of mycobacterial monooxygenase operon through phosphorylation of the transcriptional regulator VirS. J. Biol. Chem. 2009
    InteractionActivation Rv3085sourish10IDAStructural Analysis
    P. Kumar, D. Kumar et al. The Mycobacterium tuberculosis protein kinase K modulates activation of transcription from the promoter of mycobacterial monooxygenase operon through phosphorylation of the transcriptional regulator VirS. J. Biol. Chem. 2009
    InteractionActivation Rv3084sourish10IDAStructural Analysis
    P. Kumar, D. Kumar et al. The Mycobacterium tuberculosis protein kinase K modulates activation of transcription from the promoter of mycobacterial monooxygenase operon through phosphorylation of the transcriptional regulator VirS. J. Biol. Chem. 2009
    InteractionActivation Rv3084sourish10IDASpectrophotometric
    P. Kumar, D. Kumar et al. The Mycobacterium tuberculosis protein kinase K modulates activation of transcription from the promoter of mycobacterial monooxygenase operon through phosphorylation of the transcriptional regulator VirS. J. Biol. Chem. 2009
    InteractionActivation Rv3083priyadarshinipriyanka2001IDASpectrophotometric
    P. Kumar, D. Kumar et al. The Mycobacterium tuberculosis protein kinase K modulates activation of transcription from the promoter of mycobacterial monooxygenase operon through phosphorylation of the transcriptional regulator VirS. J. Biol. Chem. 2009
    InteractionActivation Rv3083priyadarshinipriyanka2001IDAStructural Analysis
    P. Kumar, D. Kumar et al. The Mycobacterium tuberculosis protein kinase K modulates activation of transcription from the promoter of mycobacterial monooxygenase operon through phosphorylation of the transcriptional regulator VirS. J. Biol. Chem. 2009
    CitationThe Mycobacterium tuberculosis protein kinase K modulates activation of transcription from the promoter of mycobacterial monooxygenase operon through phosphorylation of the transcriptional regulator VirS. P. Kumar, D. Kumar et al. J. Biol. Chem. 2009priyadarshinipriyanka2001IEP19251699Affinity purification (Physical interaction)
    InteractionActivation Rv3084priyadarshinipriyanka2001IEPAffinity purification (Physical interaction)
    P. Kumar, D. Kumar et al. The Mycobacterium tuberculosis protein kinase K modulates activation of transcription from the promoter of mycobacterial monooxygenase operon through phosphorylation of the transcriptional regulator VirS. J. Biol. Chem. 2009
    InteractionActivation Rv3085priyadarshinipriyanka2001IEPAffinity purification (Physical interaction)
    P. Kumar, D. Kumar et al. The Mycobacterium tuberculosis protein kinase K modulates activation of transcription from the promoter of mycobacterial monooxygenase operon through phosphorylation of the transcriptional regulator VirS. J. Biol. Chem. 2009
    InteractionSignaling Rv1354cswetha.rIPIYeast two-hybrid (Physical interaction)
    T. Cui, L. Zhang et al. Uncovering new signaling proteins and potential drug targets through the interactome analysis of Mycobacterium tuberculosis. BMC Genomics 2009
    InteractionRegulatedBy Rv3676yamir.morenoISOE.coli orthology based inference. Orthologous pair regulator-target found in E.coli.
    G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
    InteractionRegulatedBy Rv3291cyamir.morenoISOE.coli orthology based inference. Orthologous pair regulator-target found in E.coli.
    G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
    CitationThe temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008yamir.morenoISO18985025E.coli orthology based inference. Orthologous pair regulator-target found in E.coli.
    InteractionRegulates Rv1328yamir.morenoISOE.coli orthology based inference. Orthologous pair regulator-target found in E.coli.
    G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
    CitationThe temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008yamir.morenoISO18985025E.coli orthology based inference. Orthologous pair regulator-target found in E.coli.
    InteractionRegulates Rv1781cyamir.morenoISOE.coli orthology based inference. Orthologous pair regulator-target found in E.coli.
    G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
    CitationThe temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008yamir.morenoISO18985025E.coli orthology based inference. Orthologous pair regulator-target found in E.coli.
    InteractionRegulates Rv2117yamir.morenoISOE.coli orthology based inference. Orthologous pair regulator-target found in E.coli.
    G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
    CitationThe temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008yamir.morenoISO18985025E.coli orthology based inference. Orthologous pair regulator-target found in E.coli.
    InteractionRegulates Rv1235yamir.morenoISOE.coli orthology based inference. Orthologous pair regulator-target found in E.coli.
    G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
    CitationThe temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008yamir.morenoISO18985025E.coli orthology based inference. Orthologous pair regulator-target found in E.coli.
    InteractionRegulates Rv1237yamir.morenoISOE.coli orthology based inference. Orthologous pair regulator-target found in E.coli.
    G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
    CitationThe temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008yamir.morenoISO18985025E.coli orthology based inference. Orthologous pair regulator-target found in E.coli.
    InteractionRegulates Rv1238yamir.morenoISOE.coli orthology based inference. Orthologous pair regulator-target found in E.coli.
    G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
    InteractionRegulatedBy Rv3676yamir.morenoISOE.coli orthology based inference. Orthologous pair regulator-target found in E.coli.
    authors,M. Madan Babu,SA. Teichmann,L. Aravind Evolutionary dynamics of prokaryotic transcriptional regulatory networks. J. Mol. Biol. 2006
    InteractionRegulatedBy Rv3291cyamir.morenoISOE.coli orthology based inference. Orthologous pair regulator-target found in E.coli.
    authors,M. Madan Babu,SA. Teichmann,L. Aravind Evolutionary dynamics of prokaryotic transcriptional regulatory networks. J. Mol. Biol. 2006
    InteractionRegulates Rv1238yamir.morenoISOE.coli orthology based inference. Orthologous pair regulator-target found in E.coli.
    authors,M. Madan Babu,SA. Teichmann,L. Aravind Evolutionary dynamics of prokaryotic transcriptional regulatory networks. J. Mol. Biol. 2006
    CitationEvolutionary dynamics of prokaryotic transcriptional regulatory networks. authors,M. Madan Babu,SA. Teichmann,L. Aravind J. Mol. Biol. 2006yamir.morenoISO16530225E.coli orthology based inference. Orthologous pair regulator-target found in E.coli.
    InteractionRegulates Rv1328yamir.morenoISOE.coli orthology based inference. Orthologous pair regulator-target found in E.coli.
    authors,M. Madan Babu,SA. Teichmann,L. Aravind Evolutionary dynamics of prokaryotic transcriptional regulatory networks. J. Mol. Biol. 2006
    CitationEvolutionary dynamics of prokaryotic transcriptional regulatory networks. authors,M. Madan Babu,SA. Teichmann,L. Aravind J. Mol. Biol. 2006yamir.morenoISO16530225E.coli orthology based inference. Orthologous pair regulator-target found in E.coli.
    InteractionRegulates Rv1781cyamir.morenoISOE.coli orthology based inference. Orthologous pair regulator-target found in E.coli.
    authors,M. Madan Babu,SA. Teichmann,L. Aravind Evolutionary dynamics of prokaryotic transcriptional regulatory networks. J. Mol. Biol. 2006
    CitationEvolutionary dynamics of prokaryotic transcriptional regulatory networks. authors,M. Madan Babu,SA. Teichmann,L. Aravind J. Mol. Biol. 2006yamir.morenoISO16530225E.coli orthology based inference. Orthologous pair regulator-target found in E.coli.
    InteractionRegulates Rv2117yamir.morenoISOE.coli orthology based inference. Orthologous pair regulator-target found in E.coli.
    authors,M. Madan Babu,SA. Teichmann,L. Aravind Evolutionary dynamics of prokaryotic transcriptional regulatory networks. J. Mol. Biol. 2006
    CitationEvolutionary dynamics of prokaryotic transcriptional regulatory networks. authors,M. Madan Babu,SA. Teichmann,L. Aravind J. Mol. Biol. 2006yamir.morenoISO16530225E.coli orthology based inference. Orthologous pair regulator-target found in E.coli.
    InteractionRegulates Rv1235yamir.morenoISOE.coli orthology based inference. Orthologous pair regulator-target found in E.coli.
    authors,M. Madan Babu,SA. Teichmann,L. Aravind Evolutionary dynamics of prokaryotic transcriptional regulatory networks. J. Mol. Biol. 2006
    CitationEvolutionary dynamics of prokaryotic transcriptional regulatory networks. authors,M. Madan Babu,SA. Teichmann,L. Aravind J. Mol. Biol. 2006yamir.morenoISO16530225E.coli orthology based inference. Orthologous pair regulator-target found in E.coli.
    InteractionRegulates Rv1237yamir.morenoISOE.coli orthology based inference. Orthologous pair regulator-target found in E.coli.
    authors,M. Madan Babu,SA. Teichmann,L. Aravind Evolutionary dynamics of prokaryotic transcriptional regulatory networks. J. Mol. Biol. 2006
    CitationEvolutionary dynamics of prokaryotic transcriptional regulatory networks. authors,M. Madan Babu,SA. Teichmann,L. Aravind J. Mol. Biol. 2006yamir.morenoISO16530225E.coli orthology based inference. Orthologous pair regulator-target found in E.coli.

    Comments