TB Genome Annotation Portal

Rv3068c (pgmA)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: phosphoglucomutase alpha-D-glucose phosphate-specific
  • REFSEQ: phosphoglucomutase
  • PATRIC: Phosphoglucomutase (EC 5.4.2.2)
  • TUBERCULIST: Probable phosphoglucomutase PgmA (glucose phosphomutase) (PGM)
  • NCBI: Probable phosphoglucomutase PgmA (glucose phosphomutase) (PGM)
  • updated information (H37Rv4):
    • gene name: pgmA
    • function:
    • reference:
• Type: Not Target
• Start: 3431979
• End: 3433622
• Operon:


• Trans-membrane region:
  
• Role: I.A.1 - Carbon compounds
• GO terms:
  • GO:0071704 - organic substance metabolic process (Uniprot)
  • GO:0046872 - metal ion binding (Uniprot)
  • GO:0019388 - galactose catabolic process (Uniprot)
  • GO:0016868 - intramolecular transferase activity, phosphotransferases (Uniprot)
  • GO:0016853 - isomerase activity (Uniprot)
  • GO:0006006 - glucose metabolic process (Uniprot)
  • GO:0005978 - glycogen biosynthetic process (Uniprot)
  • GO:0005975 - carbohydrate metabolic process (Uniprot)
  • GO:0005829 - cytosol (Uniprot)
  • GO:0004614 - phosphoglucomutase activity (Uniprot)
  • GO:0000287 - magnesium ion binding (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
  • G6P[c] <=> G1P[c]
  • R1P[c] <=> R5P[c]
  • DR1P[c] <=> R5P[c]
  • GA1P[c] <=> GA6P[c]
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure:
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020):
  

  PDB	aa ident	species	PDB title
  3OLP	58%	Salmonella typhimurium	Crystal structure of a bacterial phosphoglucomutase, an enzyme important in the virulence of multiple human pathogens
  3NA5	58%	Salmonella enterica subsp. enterica serovar Typhimurium	Crystal structure of a bacterial phosphoglucomutase, an enzyme important in the virulence of several human pathogens.
  2FUV	58%	Salmonella typhimurium	Phosphoglucomutase from Salmonella typhimurium.
  2Z0F	56%	Thermus thermophilus	Crystal structure of putative phosphoglucomutase from Thermus thermophilus HB8

• Links to additional information on pgmA:
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = 0.645 (from Jeremy Rock's lab)
  • KEGG - nucleotide and amino acid sequences of gene
  • Mycobrowser
  • PATRIC
  • BioCyc
  • Systems Biology

Amino Acid Sequence

MVANPRAGQPAQPEDLVDLPHLVTAYYSIEPDPDDLAQQVAFGTSGHRGSALTGTFNELHILAITQAIVEYRAAQGTTGPLFIGRDTHGLSEPAWVSALE
VLAANQVVAVVDSRDRYTPTPAISHAILTYNRGRTEALADGIVVTPSHNPPSDGGIKYNPPNGGPADTAATTAIAKRANEILLARSMVKRLPLARALRTA
QRHDYLGHYVDDLPNVVDIAAIREAGVRIGADPLGGASVDYWGEIAHRHGLDLTVVNPLVDATWRFMTLDTDGKIRMDCSSPDAMAGLIRTMFGNRERYQ
IATGNDADADRHGIVTPDEGLLNPNHYLAVAIEYLYTHRPSWPAGIAVGKTVVSSSIIDRVVAGIGRQLVEVPVGFKWFVDGLIGATLGFGGEESAGASF
LRRDGSVWTTDKDGIIMALLAAEILAVTGATPSQRYHALAGEYGGPCYARIDAPADREQKARLARLSADQVSATELAGEPITAKLTTAPGNGAALGGLKV
TTANAWFAARPSGTEDVYKIYAESFRGPQHLVEVQQTAREVVDRVIG

Additional Information