Rv3032 (-)

Current annotations:
- TBCAP: (community-based annotations - see table at bottom of page)
- TBDB: hypothetical protein
- REFSEQ: transferase
- PATRIC: Glycosyl transferase group 1
- TUBERCULIST: Alpha (1->4) glucosyltransferase
- NCBI: Alpha (1->4) glucosyltransferase
- updated information (H37Rv4):
  - gene name: -
  - function: possible paralog of GlgA; glycogen synthase
  - reference: Koliwer-Brandl et al (2016) PMID 27513637
Type: Essential
Start: 3391534
End: 3392778
Operon:

Trans-membrane region:
Role: V - Conserved hypotheticals
GO terms:
- GO:0040007 - growth (Uniprot)
- GO:0016757 - transferase activity, transferring glycosyl groups (Uniprot)
- GO:0016740 - transferase activity (Uniprot)
- GO:0009103 - lipopolysaccharide biosynthetic process (Uniprot)
- GO:0005978 - glycogen biosynthetic process (Uniprot)
- GO:0005977 - glycogen metabolic process (Uniprot)
- GO:0005975 - carbohydrate metabolic process (Uniprot)
- GO:0004373 - glycogen (starch) synthase activity (Uniprot)
Reaction(s) (based on iSM810 metabolic model):
- ADPGLC[c] -> H[c] + ADP[c] + LINEAR-GLUCAN[c]
Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
Orthologs among selected mycobacteria
Protein structure:
Search for Homologs in PDB
Top 10 Homologs in PDB (as of Nov 2020): (none with >35% aa id)
Links to additional information on Rv3032:
- TBDB (updated)
- Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
- UniProt
- AlphaFold model
- Vulnerability = -2.174 (from Jeremy Rock's lab)
- KEGG - nucleotide and amino acid sequences of gene
- Mycobrowser
- PATRIC
- BioCyc
- Systems Biology

Amino Acid Sequence

MRILMVSWEYPPVVIGGLGRHVHHLSTALAAAGHDVVVLSRCPSGTDPSTHPSSDEVTEGVRVIAAAQDPHEFTFGNDMMAWTLAMGHAMIRAGLRLKKL
GTDRSWRPDVVHAHDWLVAHPAIALAQFYDVPMVSTIHATEAGRHSGWVSGALSRQVHAVESWLVRESDSLITCSASMNDEITELFGPGLAEITVIRNGI
DAARWPFAARRPRTGPAELLYVGRLEYEKGVHDAIAALPRLRRTHPGTTLTIAGEGTQQDWLIDQARKHRVLRATRFVGHLDHTELLALLHRADAAVLPS
HYEPFGLVALEAAAAGTPLVTSNIGGLGEAVINGQTGVSCAPRDVAGLAAAVRSVLDDPAAAQRRARAARQRLTSDFDWQTVATATAQVYLAAKRGERQP
QPRLPIVEHALPDR

(Nucleotide sequence available on KEGG)

Additional Information

possible paralog of GlgA, glycogen synthase

ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across >100 conditions *new*

Classification	Condition	Strain	Method	Reference	Notes
Essential	Sodium Oleate	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.997300; 10 non-insertions in a row out of 10 sites
Essential	Lignoceric Acid	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.999700; 10 non-insertions in a row out of 10 sites
Essential	Phosphatidylcholine	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.999750; 10 non-insertions in a row out of 10 sites
Essential	minimal media + 0.1% glycerol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 0.999700; 11 non-insertions in a row out of 11 sites
Essential	minimal media + 0.01% cholesterol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 0.999750; 11 non-insertions in a row out of 11 sites
Essential	7H10-glycerol	H37RvMA	TraSH	Sassetti et al. (2003a)
Essential	C57BL/6J mice (8 weeks)	H37RvMA	TraSH	Sassetti et al. (2003b)	Hybridization Ratio: 0.12
Growth-Defect	7H09/7H10 + rich media	H37RvMA	MotifHMM	DeJesus et al. (2017)	Fully saturated (14 reps).

TnSeq Data No data currently available.

No TnSeq data currently available for this Target.

RNASeq Data No data currently available.

No RNA-Seq data currently available for this Target.

Metabolomic Profiles No data currently available.

No Metabolomic data currently available for this Target.

Proteomic Data No data currently available.

No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology

BioCyc

Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

Interactions based on ChIPSeq data

Binds To:
- No bindings to other targets were found.
Bound By:

Interactions based on ChIPSeq data (Minch et al. 2014)

Binds To:
- No bindings to other targets were found.
Bound By:
- Rv0238 (-) (Upstream of operon)
- Rv2034 (-) (Upstream of operon)

Interactions based on TFOE data (Rustad et al. 2014)

Upregulates:
- Does not upregulate other genes.
Upregulated by:
- Not upregulated by other genes.
Downregulates:
- Does not downregulate other genes.
Downregulated by:

Property	Value	Creator	Evidence	PMID	Comment
Name	alpha-1,4-glucosyltransferase involved in glycogen, methylglucose lipopolysaccharides and capsular D-glucan synthesis	mjackson	IMP		Other (lipo)polysaccharides [Methylglucose lipolysaccharides, glycogen and capsular alpha-1,4 glucan]
Name	alpha-1,4-glucosyltransferase involved in glycogen, methylglucose lipopolysaccharides and capsular D-glucan synthesis	mjackson	IDA		Other (lipo)polysaccharides [Methylglucose lipolysaccharides, glycogen and capsular alpha-1,4 glucan]
Other	TBPWY:(MGLP and alpha-1,4 glucans)	mjackson			alpha-1,4-glucosyltransferase involved in glycogen, methylglucose lipopolysaccharides and capsular D-glucan synthesis (phenotypic [mycobacterial recombinant strains]; enzymatic) T. Sambou, P. Dinadayala et al. Capsular glucan and intracellular glycogen of Mycobacterium tuberculosis: biosynthesis and impact on the persistence in mice. Mol. Microbiol. 2008
Citation	Polymethylated polysaccharides from Mycobacterium species revisited. authors,M. Jackson,PJ. Brennan J. Biol. Chem. 2009	mjackson		18786916	alpha-1,4-glucosyltransferase involved in glycogen, methylglucose lipopolysaccharides and capsular D-glucan synthesis (phenotypic [mycobacterial recombinant strains]; enzymatic)
Other	TBPWY:(MGLP and alpha-1,4 glucans)	mjackson			alpha-1,4-glucosyltransferase involved in glycogen, methylglucose lipopolysaccharides and capsular D-glucan synthesis (phenotypic [mycobacterial recombinant strains]; enzymatic) authors,M. Jackson,PJ. Brennan Polymethylated polysaccharides from Mycobacterium species revisited. J. Biol. Chem. 2009
Citation	Genetic basis for the biosynthesis of methylglucose lipopolysaccharides in Mycobacterium tuberculosis. G. Stadthagen, T. Sambou et al. J. Biol. Chem. 2007	mjackson		17640872	alpha-1,4-glucosyltransferase involved in glycogen, methylglucose lipopolysaccharides and capsular D-glucan synthesis (phenotypic [mycobacterial recombinant strains]; enzymatic)
Other	TBPWY:(MGLP and alpha-1,4 glucans)	mjackson			alpha-1,4-glucosyltransferase involved in glycogen, methylglucose lipopolysaccharides and capsular D-glucan synthesis (phenotypic [mycobacterial recombinant strains]; enzymatic) G. Stadthagen, T. Sambou et al. Genetic basis for the biosynthesis of methylglucose lipopolysaccharides in Mycobacterium tuberculosis. J. Biol. Chem. 2007
Citation	Capsular glucan and intracellular glycogen of Mycobacterium tuberculosis: biosynthesis and impact on the persistence in mice. T. Sambou, P. Dinadayala et al. Mol. Microbiol. 2008	mjackson		18808383	alpha-1,4-glucosyltransferase involved in glycogen, methylglucose lipopolysaccharides and capsular D-glucan synthesis (phenotypic [mycobacterial recombinant strains]; enzymatic)

TB Genome Annotation Portal