TB Genome Annotation Portal

Rv2988c (leuC)

Amino Acid Sequence

MALQTGEPRTLAEKIWDDHIVVSGGGCAPDLIYIDLHLVHEVTSPQAFDGLRLAGRRVRRPELTLATEDHNVPTVDIDQPIADPVSRTQVETLRRNCAEF
GIRLHSMGDIEQGIVHVVGPQLGLTQPGMTIVCGDSHTSTHGAFGALAMGIGTSEVEHVLATQTLPLRPFKTMAVNVDGRLPDGVSAKDIILALIAKIGT
GGGQGHVIEYRGSAIESLSMEGRMTICNMSIEAGARAGMVAPDETTYAFLRGRPHAPTGAQWDTALVYWQRLRTDVGAVFDTEVYLDAASLSPFVTWGTN
PGQGVPLAAAVPDPQLMTDDAERQAAEKALAYMDLRPGTAMRDIAVDAVFVGSCTNGRIEDLRVVAEVLRGRKVADGVRMLIVPGSMRVRAQAEAEGLGE
IFTDAGAQWRQAGCSMCLGMNPDQLASGERCAATSNRNFEGRQGAGGRTHLVSPAVAAATAVRGTLSSPADLN
(Nucleotide sequence available on KEGG)

Additional Information



ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across >100 conditions *new*

Classification Condition Strain Method Reference Notes
Essential Sodium Oleate H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: 0.999700;
13 non-insertions in a row out of 13 sites
Essential Lignoceric Acid H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: 1.000000;
13 non-insertions in a row out of 13 sites
Essential Phosphatidylcholine H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: 0.999900;
13 non-insertions in a row out of 13 sites
Essential minimal media + 0.1% glycerol H37RvMA Gumbel Griffin et al. (2011) Probability of Essentiality: 1.000000;
13 non-insertions in a row out of 13 sites
Essential minimal media + 0.01% cholesterol H37RvMA Gumbel Griffin et al. (2011) Probability of Essentiality: 0.999950;
13 non-insertions in a row out of 13 sites
No-Data 7H10-glycerol H37RvMA TraSH Sassetti et al. (2003a)
Too-Short C57BL/6J mice (8 weeks) H37RvMA TraSH Sassetti et al. (2003b) Hybridization Ratio: -1
Growth-Defect 7H09/7H10 + rich media H37RvMA MotifHMM DeJesus et al. (2017) Fully saturated (14 reps).

TnSeq Data No data currently available.
  • No TnSeq data currently available for this Target.
RNASeq Data No data currently available.
  • No RNA-Seq data currently available for this Target.
Metabolomic Profiles No data currently available.
  • No Metabolomic data currently available for this Target.
Proteomic Data No data currently available.
  • No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology
  • BioCyc

    Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

    NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

    Interactions based on ChIPSeq data

  • Interactions based on ChIPSeq data (Minch et al. 2014)

    Interactions based on TFOE data (Rustad et al. 2014)



    TBCAP

    Tubculosis Community Annotation Project (
    Slayden et al., 2013)

    Rv2988c (leuC)

    PropertyValueCreatorEvidencePMIDComment
    InteractionPhysicalInteraction Rv2987ckholia.truptiNASStructural Analysis
    N. Koon, CJ. Squire et al. Crystal structure of LeuA from Mycobacterium tuberculosis, a key enzyme in leucine biosynthesis. Proc. Natl. Acad. Sci. U.S.A. 2004
    InteractionPhysicalInteraction Rv2987ckholia.truptiNASStructural Analysis
    M. Karuppasamy, A. Geerlof et al. Cloning, expression, purification, crystallization and preliminary X-ray diffraction analysis of the small subunit of isopropylmalate isomerase (Rv2987c) from Mycobacterium tuberculosis. Acta Crystallogr. Sect. F Struct. Biol. Cryst. Commun. 2009
    InteractionPhysicalInteraction Rv2987ckholia.truptiNASSpectrophotometric
    MK. Hondalus, S. Bardarov et al. Attenuation of and protection induced by a leucine auxotroph of Mycobacterium tuberculosis. Infect. Immun. 2000
    InteractionPhysicalInteraction Rv2987ckholia.truptiNASSpectrophotometric
    N. Koon, CJ. Squire et al. Crystal structure of LeuA from Mycobacterium tuberculosis, a key enzyme in leucine biosynthesis. Proc. Natl. Acad. Sci. U.S.A. 2004
    InteractionPhysicalInteraction Rv2987ckholia.truptiNASSpectrophotometric
    M. Karuppasamy, A. Geerlof et al. Cloning, expression, purification, crystallization and preliminary X-ray diffraction analysis of the small subunit of isopropylmalate isomerase (Rv2987c) from Mycobacterium tuberculosis. Acta Crystallogr. Sect. F Struct. Biol. Cryst. Commun. 2009
    InteractionPhysicalInteraction Rv2987ckholia.truptiNASStructural Analysis
    MK. Hondalus, S. Bardarov et al. Attenuation of and protection induced by a leucine auxotroph of Mycobacterium tuberculosis. Infect. Immun. 2000
    InteractionRegulatedBy Rv3291cyamir.morenoISOE.coli orthology based inference. Orthologous pair regulator-target found in E.coli.
    G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
    InteractionRegulatedBy Rv0491yamir.morenoIEPMicroarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
    T. Parish, DA. Smith et al. The senX3-regX3 two-component regulatory system of Mycobacterium tuberculosis is required for virulence. Microbiology (Reading, Engl.) 2003

    Comments