TB Genome Annotation Portal

Rv2973c (recG)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: ATP-dependent DNA helicase recG
  • REFSEQ: ATP-dependent DNA helicase RecG
  • PATRIC: ATP-dependent DNA helicase RecG (EC 3.6.1.-)
  • TUBERCULIST: Probable ATP-dependent DNA helicase RecG
  • NCBI: Probable ATP-dependent DNA helicase RecG
  • updated information (H37Rv4):
    • gene name: recG
    • function:
    • reference:
• Type: Not Target
• Start: 3327733
• End: 3329946
• Operon:


• Trans-membrane region:
  
• Role: II.A.5 - DNA replication, repair, recombination and restriction/modification
• GO terms:
  • GO:0032508 - DNA duplex unwinding (Uniprot)
  • GO:0016787 - hydrolase activity (Uniprot)
  • GO:0010501 - RNA secondary structure unwinding (Uniprot)
  • GO:0006974 - cellular response to DNA damage stimulus (Uniprot)
  • GO:0006310 - DNA recombination (Uniprot)
  • GO:0006281 - DNA repair (Uniprot)
  • GO:0005886 - plasma membrane (Uniprot)
  • GO:0005737 - cytoplasm (Uniprot)
  • GO:0005524 - ATP binding (Uniprot)
  • GO:0004386 - helicase activity (Uniprot)
  • GO:0004004 - ATP-dependent RNA helicase activity (Uniprot)
  • GO:0004003 - ATP-dependent DNA helicase activity (Uniprot)
  • GO:0003677 - DNA binding (Uniprot)
  • GO:0003676 - nucleic acid binding (Uniprot)
  • GO:0000166 - nucleotide binding (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure:
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020):
  

  PDB	aa ident	species	PDB title
  1GM5	35%	THERMOTOGA MARITIMA	Structure of RecG bound to three-way DNA junction

• Links to additional information on recG:
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = -0.515 (from Jeremy Rock's lab)
  • KEGG - nucleotide and amino acid sequences of gene
  • Mycobrowser
  • PATRIC
  • BioCyc
  • Systems Biology

Amino Acid Sequence

VASLSDRLDRVLGATAADALDEQFGMRTVDDLLRHYPRSYVEGAARVGIGDARPEAGEHITIVDVITDTYSFPMKKKPNRKCLRITVGGGRNKVTATFFN
ADYIMRDLTKHTKVMLSGEVGYYKGAMQLTHPAFLILDSPDGKNHGTRSLKSIADASKAISGELVVEEFERRFFPIYPASTKVQSWDIFKCVRQVLDVLD
RVDDPLPAELRAKHGLIPEDEALRAIHLAESQSLRERARERLTFDEAVGLQWALVARRHGELSESGPSAAWKSNGLAAELLRRLPFELTAGQREVLDVLS
DGLAANRPLNRLLQGEVGSGKTIVAVLAMLQMVDAGYQCALLAPTEVLAAQHLRSIRDVLGPLAMGGQLGGAENATRVALLTGSMTAGQKKQVRAEIASG
QVGIVIGTHALLQEAVDFHNLGMVVVDEQHRFGVEQRDQLRAKAPAGITPHLLVMTATPIPRTVALTVYGDLETSTLRELPLGRQPIATNVIFVKDKPAW
LDRAWRRIIEEAAAGRQAYVVAPRIDESDDTDVQGGVRPSATAEGLFSRLRSAELAELRLALMHGRLSADDKDAAMAAFRAGEVDVLVCTTVIEVGVDVP
NATVMLVMDADRFGISQLHQLRGRIGRGEHPSVCLLASWVPPDTPAGQRLRAVAGTMDGFALADLDLKERKEGDVLGRNQSGKAITLRLLSLAEHEEYIV
AARDFCIEAYKNPTDPALALMAARFTSTDRIEYLDKS

Additional Information

Analysis of Positive Selection in Clinical Isolates *new*

• Analysis of dN/dS (omega) in two collections of Mtb clinical isolates using GenomegaMap (Window model) (see description of methods)
  • Moldova: 2,057 clinical isolates
  • global set: 5,195 clinical isolates from 15 other countries
• In the omega plots, the black line shows the mean estimate of omega (dN/dS) at each codon, and the blue lines are the bounds for the 95% credible interval (95%CI, from MCMC sampling).
• A gene is under significant positive selection if the lower-bound of the 95%CI of omega (lower blue line) exceeds 1.0 at any codon.

	Moldova (2,057)	global set (5,195)
under significant positive selection?	NO	YES
omega peak height (95%CI lower bound)	1.62 (0.23)	2.56 (1.14)
codons under selection		374, 375, 376, 377, 378, 379, 380, 381, 382, 383, 385, 386, 387, 388
omega plots
genetic variants*	link	link
statistics at each codon	link	link