TB Genome Annotation Portal

Rv2967c (pca)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: pyruvate carboxylase
  • REFSEQ: pyruvate carboxylase
  • PATRIC: Pyruvate carboxyl transferase (EC 6.4.1.1)
  • TUBERCULIST: Probable pyruvate carboxylase Pca (pyruvic carboxylase)
  • NCBI: Probable pyruvate carboxylase Pca (pyruvic carboxylase)
  • updated information (H37Rv4):
    • gene name: pca
    • function:
    • reference:
• Type: Not Target
• Start: 3319663
• End: 3323046
• Operon:


• Trans-membrane region:
  
• Role: I.B.3 - TCA cycle
• GO terms:
  • GO:0046872 - metal ion binding (Uniprot)
  • GO:0016874 - ligase activity (Uniprot)
  • GO:0009374 - biotin binding (Uniprot)
  • GO:0006094 - gluconeogenesis (Uniprot)
  • GO:0006090 - pyruvate metabolic process (Uniprot)
  • GO:0005524 - ATP binding (Uniprot)
  • GO:0004736 - pyruvate carboxylase activity (Uniprot)
  • GO:0003824 - catalytic activity (Uniprot)
  • GO:0000166 - nucleotide binding (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
  • PYR[c] + BIOTIN_CO2[c] <=> OA[c] + 0.999 BIOTIN[c]
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure:
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020):
  

  PDB	aa ident	species	PDB title
  2DZD	51%	Geobacillus thermodenitrificans	Crystal structure of the biotin carboxylase domain of pyruvate carboxylase
  3U9T	47%	Pseudomonas aeruginosa	Crystal structure of P. aeruginosa 3-methylcrotonyl-CoA carboxylase (MCC) 750 kD holoenzyme, free enzyme
  3U9S	47%	Pseudomonas aeruginosa	Crystal structure of P. aeruginosa 3-methylcrotonyl-CoA carboxylase (MCC) 750 kD holoenzyme, CoA complex
  2QF7	46%	Rhizobium etli	Crystal structure of a complete multifunctional pyruvate carboxylase from Rhizobium etli
  3TW7	46%	Rhizobium etli	Structure of Rhizobium etli pyruvate carboxylase T882A crystallized without acetyl coenzyme-A
  3TW6	46%	Rhizobium etli	Structure of Rhizobium etli pyruvate carboxylase T882A with the allosteric activator, acetyl coenzyme-A
  4QSL	46%	Listeria monocytogenes	Crystal Structure of Listeria Monocytogenes Pyruvate Carboxylase
  4QSK	46%	Listeria monocytogenes	Crystal Structure of L. monocytogenes Pyruvate Carboxylase in complex with Cyclic-di-AMP
  4QSH	46%	Listeria monocytogenes	Crystal Structure of L. monocytogenes Pyruvate Carboxylase in complex with Cyclic-di-AMP
  4HNT	46%	Staphylococcus aureus	crystal structure of F403A mutant of S. aureus Pyruvate carboxylase

• Links to additional information on pca:
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = 0.02 (from Jeremy Rock's lab)
  • KEGG - nucleotide and amino acid sequences of gene
  • Mycobrowser
  • PATRIC
  • BioCyc
  • Systems Biology

Amino Acid Sequence

VFSKVLVANRGEIAIRAFRAAYELGVGTVAVYPYEDRNSQHRLKADESYQIGDIGHPVHAYLSVDEIVATARRAGADAIYPGYGFLSENPDLAAACAAAG
ISFVGPSAEVLELAGNKSRAIAAAREAGLPVLMSSAPSASVDELLSVAAGMPFPLFVKAVAGGGGRGMRRVGDIAALPEAIEAASREAESAFGDPTVYLE
QAVINPRHIEVQILADNLGDVIHLYERDCSVQRRHQKVIELAPAPHLDAELRYKMCVDAVAFARHIGYSCAGTVEFLLDERGEYVFIEMNPRVQVEHTVT
EEITDVDLVASQLRIAAGETLEQLGLRQEDIAPHGAALQCRITTEDPANGFRPDTGRISALRTAGGAGVRLDGSTNLGAEISPYFDSMLVKLTCRGRDLP
TAVSRARRAIAEFRIRGVSTNIPFLQAVLDDPDFRAGRVTTSFIDERPQLLTARASADRGTKILNFLADVTVNNPYGSRPSTIYPDDKLPDLDLRAAPPA
GSKQRLVKLGPEGFARWLRESAAVGVTDTTFRDAHQSLLATRVRTSGLSRVAPYLARTMPQLLSVECWGGATYDVALRFLKEDPWERLATLRAAMPNICL
QMLLRGRNTVGYTPYPEIVTSAFVQEATATGIDIFRIFDALNNIESMRPAIDAVRETGSAIAEVAMCYTGDLTDPGEQLYTLDYYLKLAEQIVDAGAHVL
AIKDMAGLLRPPAAQRLVSALRSRFDLPVHLHTHDTPGGQLASYVAAWHAGADAVDGAAAPLAGTTSQPALSSIVAAAAHTEYDTGLSLSAVCALEPYWE
ALRKVYAPFESGLPGPTGRVYHHEIPGGQLSNLRQQAIALGLGDRFEEIEEAYAGADRVLGRLVKVTPTSKVVGDLALALVGAGVSADEFASDPARFGIP
ESVLGFLRGELGDPPGGWPEPLRTAALAGRGAARPTAQLAADDEIALSSVGAKRQATLNRLLFPSPTKEFNEHREAYGDTSQLSANQFFYGLRQGEEHRV
KLERGVELLIGLEAISEPDERGMRTVMCILNGQLRPVLVRDRSIASAVPAAEKADRGNPGHIAAPFAGVVTVGVCVGERVGAGQTIATIEAMKMEAPITA
PVAGTVERVAVSDTAQVEGGDLLVVVS

Additional Information