TB Genome Annotation Portal

Rv2962c (-)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: PGL/p-HBAD biosynthesis rhamnosyltransferase
  • REFSEQ: glycosyl transferase
  • PATRIC: PGL/p-HBAD biosynthesis rhamnosyltransferase
  • TUBERCULIST: Possible glycosyl transferase
  • NCBI: Possible glycosyl transferase
  • updated information (H37Rv4):
    • gene name: -
    • function:
    • reference:
• Type: Not Target
• Start: 3313773
• End: 3315122
• Operon:


• Trans-membrane region:
  
• Role: IV.H - Miscellaneous transferases
• GO terms:
  • GO:0043231 - intracellular membrane-bounded organelle (Uniprot)
  • GO:0020012 - evasion or tolerance of host immune response (Uniprot)
  • GO:0016758 - transferase activity, transferring hexosyl groups (Uniprot)
  • GO:0016757 - transferase activity, transferring glycosyl groups (Uniprot)
  • GO:0016740 - transferase activity (Uniprot)
  • GO:0009247 - glycolipid biosynthetic process (Uniprot)
  • GO:0008194 - UDP-glycosyltransferase activity (Uniprot)
  • GO:0008152 - metabolic process (Uniprot)
  • GO:0005886 - plasma membrane (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
  • HBA[c] + DTDPRHAM[c] -> DTDP[c] + HBARHAM1[c]
  • PHDIM[c] + DTDPRHAM[c] -> DTDP[c] + PHDIMRHAM1[c]
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure:
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020):
  

  PDB	aa ident	species	PDB title
  3OTH	36%	Micromonospora echinospora	Crystal Structure of CalG1, Calicheamicin Glycostyltransferase, TDP and calicheamicin alpha3I bound form
  3OTG	36%	Micromonospora echinospora	Crystal Structure of CalG1, Calicheamicin Glycostyltransferase, TDP bound form

• Links to additional information on Rv2962c:
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = 0.922 (from Jeremy Rock's lab)
  • KEGG - nucleotide and amino acid sequences of gene
  • Mycobrowser
  • PATRIC
  • BioCyc
  • Systems Biology

Amino Acid Sequence

VRVSCVYATASRWGGPPVASEVRGDAAISTTPDAAPGLAARRRRILFVAEAVTLAHVVRPFALAQSLDPSRYEVHFACDPRYNQLLGPLPFRHHAIHTIP
SERFFGNLTQGRFYAMRTLRKYVEADLRVLDEIAPDLVVGDLRISLSVSARLAGIPYIAIANAYWSPYAQRRFPLPDVIWTRLFGVRLVKLLYRLERPLL
FALQCMPLNWVRRRHGLSSLGWNLCRIFTDGDHTLYADVPELMPTYDLPANHEYLGPVLWSPAGKPPTWWDSLPTDRPIVYATLGTSGGRNLLQLVLNAL
AELPVTVIAATAGRSDLKTVPANAFVADYLPGEAAAARSAVVVCNGGSLTTQQALVAGVPVIGVAGNLDQHLNMEAVERAGAGVLLRTERLKSQRVAGAV
MQVISRSEYRQAAARLADAFGRDRVGFPQHVENALRLMPENRPRTWLAS

Additional Information