Rv2958c (-)

Current annotations:
- TBCAP: (community-based annotations - see table at bottom of page)
- TBDB: inactive PGL/p-HBAD biosynthesis glycosyltransferase
- REFSEQ: glycosyl transferase
- PATRIC: UDP-glucoronosyl and UDP-glucosyltransferases family protein
- TUBERCULIST: Possible glycosyl transferase
- NCBI: Possible glycosyl transferase
- updated information (H37Rv4):
  - gene name: -
  - function:
  - reference:
Type: Not Target
Start: 3310714
End: 3312000
Operon:

Trans-membrane region:
Role: IV.H - Miscellaneous transferases
GO terms:
- GO:0043231 - intracellular membrane-bounded organelle (Uniprot)
- GO:0020012 - evasion or tolerance of host immune response (Uniprot)
- GO:0016758 - transferase activity, transferring hexosyl groups (Uniprot)
- GO:0016757 - transferase activity, transferring glycosyl groups (Uniprot)
- GO:0016740 - transferase activity (Uniprot)
- GO:0009405 - pathogenesis (Uniprot)
- GO:0009247 - glycolipid biosynthetic process (Uniprot)
- GO:0008194 - UDP-glycosyltransferase activity (Uniprot)
- GO:0008152 - metabolic process (Uniprot)
- GO:0005886 - plasma membrane (Uniprot)
Reaction(s) (based on iSM810 metabolic model):
- HBA[c] + DTDPRHAM[c] -> DTDP[c] + HBARHAM2[c]
- DTDPRHAM[c] + PHDIMRHAM1[c] -> DTDP[c] + PHDIMRHAM2[c]
Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
Orthologs among selected mycobacteria
Protein structure:
Search for Homologs in PDB
Top 10 Homologs in PDB (as of Nov 2020): (none with >35% aa id)
Links to additional information on Rv2958c:
- TBDB (updated)
- Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
- UniProt
- AlphaFold model
- Vulnerability = 0.759 (from Jeremy Rock's lab)
- KEGG - nucleotide and amino acid sequences of gene
- Mycobrowser
- PATRIC
- BioCyc
- Systems Biology

Amino Acid Sequence

MEETSVAGDPGPDAGTSTAPNAAPEPVARRQRILFVGEAATLAHVVRPFVLARSLDPSRYEVHFACDPRFNKLLGPLPFPHHPIHTVPSEEVLLKIAQGR
LFYNTRTLRKYIAADRKILNEIAPDVVVGDNRLSLSVSARLAGIPYIAIANAYWSPQARRRFPLPDVPWTRFFGVRPVSILYRLYRPLIFALYCLPLNWL
RRKHGLSSLGWDLCRIFTDGDYTLYADVPELVPTYNLPANHRYLGPVLWSPDVKPPTWWHSLPTDRPIIYATLGSSGGKNLLQVVLNALADLPVTVIAAT
AGRNHLKNVPANAFVADYLPGEAAAARSAVVLCNGGSPTTQQALAAGVPVIGLPSNMDQHLNMEALERAGAGVLLRTERLNTEGVAAAVKQVLSGAEFRQ
AARRLAEAFGPDFAGFPQHIESALRLVC

(Nucleotide sequence available on KEGG)

Additional Information

ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across >100 conditions *new*

Classification	Condition	Strain	Method	Reference	Notes
Non-Essential	Sodium Oleate	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.000000; 1 non-insertions in a row out of 24 sites
Non-Essential	Lignoceric Acid	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.000000; 1 non-insertions in a row out of 24 sites
Non-Essential	Phosphatidylcholine	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.000000; 0 non-insertions in a row out of 24 sites
Non-Essential	minimal media + 0.1% glycerol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 0.000000; 1 non-insertions in a row out of 25 sites
Non-Essential	minimal media + 0.01% cholesterol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 0.000000; 2 non-insertions in a row out of 25 sites
Non-Essential	7H10-glycerol	H37RvMA	TraSH	Sassetti et al. (2003a)
Non-Essential	C57BL/6J mice (8 weeks)	H37RvMA	TraSH	Sassetti et al. (2003b)	Hybridization Ratio: 2.71
Growth-Advantage	7H09/7H10 + rich media	H37RvMA	MotifHMM	DeJesus et al. (2017)	Fully saturated (14 reps).

TnSeq Data No data currently available.

No TnSeq data currently available for this Target.

RNASeq Data No data currently available.

No RNA-Seq data currently available for this Target.

Metabolomic Profiles No data currently available.

No Metabolomic data currently available for this Target.

Proteomic Data No data currently available.

No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology

BioCyc

Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

Interactions based on ChIPSeq data

Binds To:
- No bindings to other targets were found.
Bound By:

Interactions based on ChIPSeq data (Minch et al. 2014)

Binds To:
- No bindings to other targets were found.
Bound By:
- Rv0047c (-) (Direct binding)

Interactions based on TFOE data (Rustad et al. 2014)

Upregulates:
- Does not upregulate other genes.
Upregulated by:
- Rv1994c (cmtR)
Downregulates:
- Does not downregulate other genes.
Downregulated by:

TBCAP

Tubculosis Community Annotation Project (

Slayden et al., 2013

Rv2958c (-)

Property	Value	Creator	Evidence	PMID	Comment
Term	TBRXN:RRPPDIMAS rhamnose rhamnose phenol phthiocerol dimycocerosate synthesis - IMP	njamshidi	IMP	15292272	See PMID: 15292272 and 10540187. Whether rhamnose or methoxy-ramnose is transfered is not yet clear, also the rhamnose donor has not been shown specifically to be dtdprmn authors,J. Fldt,C. Dahlgren,A. Karlsson,AM. Ahmed,DE. Minnikin,M. Ridell Activation of human neutrophils by mycobacterial phenolic glycolipids. Clin. Exp. Immunol. 1999
Citation	Characterization of three glycosyltransferases involved in the biosynthesis of the phenolic glycolipid antigens from the Mycobacterium tuberculosis complex. E. Prez, P. Constant et al. J. Biol. Chem. 2004	njamshidi	ISS	15292272	See PMID: 15292272 and 10540187. Whether rhamnose or methoxy-ramnose is transfered is not yet clear, also the rhamnose donor has not been shown specifically to be dtdprmn
Term	TBRXN:RRPPDIMAS rhamnose rhamnose phenol phthiocerol dimycocerosate synthesis - ISS	njamshidi	ISS	15292272	See PMID: 15292272 and 10540187. Whether rhamnose or methoxy-ramnose is transfered is not yet clear, also the rhamnose donor has not been shown specifically to be dtdprmn E. Prez, P. Constant et al. Characterization of three glycosyltransferases involved in the biosynthesis of the phenolic glycolipid antigens from the Mycobacterium tuberculosis complex. J. Biol. Chem. 2004
Citation	Activation of human neutrophils by mycobacterial phenolic glycolipids. authors,J. Fldt,C. Dahlgren,A. Karlsson,AM. Ahmed,DE. Minnikin,M. Ridell Clin. Exp. Immunol. 1999	njamshidi	ISS	15292272\|10540187	See PMID: 15292272 and 10540187. Whether rhamnose or methoxy-ramnose is transfered is not yet clear, also the rhamnose donor has not been shown specifically to be dtdprmn
Term	TBRXN:RRPPDIMAS rhamnose rhamnose phenol phthiocerol dimycocerosate synthesis - ISS	njamshidi	ISS	15292272	See PMID: 15292272 and 10540187. Whether rhamnose or methoxy-ramnose is transfered is not yet clear, also the rhamnose donor has not been shown specifically to be dtdprmn authors,J. Fldt,C. Dahlgren,A. Karlsson,AM. Ahmed,DE. Minnikin,M. Ridell Activation of human neutrophils by mycobacterial phenolic glycolipids. Clin. Exp. Immunol. 1999
Citation	Characterization of three glycosyltransferases involved in the biosynthesis of the phenolic glycolipid antigens from the Mycobacterium tuberculosis complex. E. Prez, P. Constant et al. J. Biol. Chem. 2004	njamshidi	IMP	15292272	See PMID: 15292272 and 10540187. Whether rhamnose or methoxy-ramnose is transfered is not yet clear, also the rhamnose donor has not been shown specifically to be dtdprmn
Term	TBRXN:RRPPDIMAS rhamnose rhamnose phenol phthiocerol dimycocerosate synthesis - IMP	njamshidi	IMP	15292272	See PMID: 15292272 and 10540187. Whether rhamnose or methoxy-ramnose is transfered is not yet clear, also the rhamnose donor has not been shown specifically to be dtdprmn E. Prez, P. Constant et al. Characterization of three glycosyltransferases involved in the biosynthesis of the phenolic glycolipid antigens from the Mycobacterium tuberculosis complex. J. Biol. Chem. 2004
Citation	Activation of human neutrophils by mycobacterial phenolic glycolipids. authors,J. Fldt,C. Dahlgren,A. Karlsson,AM. Ahmed,DE. Minnikin,M. Ridell Clin. Exp. Immunol. 1999	njamshidi	IMP	15292272\|10540187	See PMID: 15292272 and 10540187. Whether rhamnose or methoxy-ramnose is transfered is not yet clear, also the rhamnose donor has not been shown specifically to be dtdprmn
Interaction	Operon Rv2959c	priti.priety	IMP		Methylation interface E. Prez, P. Constant et al. Molecular dissection of the role of two methyltransferases in the biosynthesis of phenolglycolipids and phthiocerol dimycoserosate in the Mycobacterium tuberculosis complex. J. Biol. Chem. 2004
Name	Rhamnosyltransferase responsible for the transfer of the second rhamnosyl residue of the triglycosyl appendage of phenolic glycolipids and p-hydroxybenzoic acid derivatives	mjackson	IMP		Phthiocerol dimycocerosates (PDIM), phenolic glycolipids (PGL) and para-hydroxybenzoic acid derivatives
Citation	Characterization of three glycosyltransferases involved in the biosynthesis of the phenolic glycolipid antigens from the Mycobacterium tuberculosis complex. E. Prez, P. Constant et al. J. Biol. Chem. 2004	mjackson		15292272	Rhamnosyltransferase responsible for the transfer of the second rhamnosyl residue of the triglycosyl appendage of phenolic glycolipids and p-hydroxybenzoic acid derivatives (phenotypic [mycobacterial recombinant strains])
Other	TBPWY:Phthiocerol dimycocerosates, PGL & pHBAD	mjackson			Rhamnosyltransferase responsible for the transfer of the second rhamnosyl residue of the triglycosyl appendage of phenolic glycolipids and p-hydroxybenzoic acid derivatives (phenotypic [mycobacterial recombinant strains]) E. Prez, P. Constant et al. Characterization of three glycosyltransferases involved in the biosynthesis of the phenolic glycolipid antigens from the Mycobacterium tuberculosis complex. J. Biol. Chem. 2004

Property

Value

Creator

Evidence

PMID

Comment

Term

TBRXN:RRPPDIMAS rhamnose rhamnose phenol phthiocerol dimycocerosate synthesis - IMP

njamshidi

IMP

15292272

See PMID: 15292272 and 10540187. Whether rhamnose or methoxy-ramnose is transfered is not yet clear, also the rhamnose donor has not been shown specifically to be dtdprmn
authors,J. Fldt,C. Dahlgren,A. Karlsson,AM. Ahmed,DE. Minnikin,M. Ridell Activation of human neutrophils by mycobacterial phenolic glycolipids. Clin. Exp. Immunol. 1999

Citation

Characterization of three glycosyltransferases involved in the biosynthesis of the phenolic glycolipid antigens from the Mycobacterium tuberculosis complex. E. Prez, P. Constant et al. J. Biol. Chem. 2004

njamshidi

ISS

15292272

See PMID: 15292272 and 10540187. Whether rhamnose or methoxy-ramnose is transfered is not yet clear, also the rhamnose donor has not been shown specifically to be dtdprmn

Term

TBRXN:RRPPDIMAS rhamnose rhamnose phenol phthiocerol dimycocerosate synthesis - ISS

njamshidi

ISS

15292272

See PMID: 15292272 and 10540187. Whether rhamnose or methoxy-ramnose is transfered is not yet clear, also the rhamnose donor has not been shown specifically to be dtdprmn
E. Prez, P. Constant et al. Characterization of three glycosyltransferases involved in the biosynthesis of the phenolic glycolipid antigens from the Mycobacterium tuberculosis complex. J. Biol. Chem. 2004

Citation

Activation of human neutrophils by mycobacterial phenolic glycolipids. authors,J. Fldt,C. Dahlgren,A. Karlsson,AM. Ahmed,DE. Minnikin,M. Ridell Clin. Exp. Immunol. 1999

njamshidi

ISS

15292272|10540187

See PMID: 15292272 and 10540187. Whether rhamnose or methoxy-ramnose is transfered is not yet clear, also the rhamnose donor has not been shown specifically to be dtdprmn

Term

TBRXN:RRPPDIMAS rhamnose rhamnose phenol phthiocerol dimycocerosate synthesis - ISS

njamshidi

ISS

15292272

Citation

njamshidi

IMP

15292272

See PMID: 15292272 and 10540187. Whether rhamnose or methoxy-ramnose is transfered is not yet clear, also the rhamnose donor has not been shown specifically to be dtdprmn

Term

TBRXN:RRPPDIMAS rhamnose rhamnose phenol phthiocerol dimycocerosate synthesis - IMP

njamshidi

IMP

15292272

Citation

Activation of human neutrophils by mycobacterial phenolic glycolipids. authors,J. Fldt,C. Dahlgren,A. Karlsson,AM. Ahmed,DE. Minnikin,M. Ridell Clin. Exp. Immunol. 1999

njamshidi

IMP

15292272|10540187

See PMID: 15292272 and 10540187. Whether rhamnose or methoxy-ramnose is transfered is not yet clear, also the rhamnose donor has not been shown specifically to be dtdprmn

Interaction

Operon Rv2959c

priti.priety

IMP

Methylation interface
E. Prez, P. Constant et al. Molecular dissection of the role of two methyltransferases in the biosynthesis of phenolglycolipids and phthiocerol dimycoserosate in the Mycobacterium tuberculosis complex. J. Biol. Chem. 2004

Name

Rhamnosyltransferase responsible for the transfer of the second rhamnosyl residue of the triglycosyl appendage of phenolic glycolipids and p-hydroxybenzoic acid derivatives

mjackson

IMP

Phthiocerol dimycocerosates (PDIM), phenolic glycolipids (PGL) and para-hydroxybenzoic acid derivatives

Citation

mjackson

15292272

Other

TBPWY:Phthiocerol dimycocerosates, PGL & pHBAD

mjackson

Rhamnosyltransferase responsible for the transfer of the second rhamnosyl residue of the triglycosyl appendage of phenolic glycolipids and p-hydroxybenzoic acid derivatives (phenotypic [mycobacterial recombinant strains])
E. Prez, P. Constant et al. Characterization of three glycosyltransferases involved in the biosynthesis of the phenolic glycolipid antigens from the Mycobacterium tuberculosis complex. J. Biol. Chem. 2004

Comments