TB Genome Annotation Portal

Rv2957 (-)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: PGL/p-HBAD biosynthesis glycosyltransferase
  • REFSEQ: glycosyl transferase
  • PATRIC: PGL/p-HBAD biosynthesis glycosyltransferase
  • TUBERCULIST: Possible glycosyl transferase
  • NCBI: Possible glycosyl transferase
  • updated information (H37Rv4):
    • gene name: -
    • function:
    • reference:
• Type: Not Target
• Start: 3309470
• End: 3310297
• Operon:


• Trans-membrane region:
  
• Role: IV.H - Miscellaneous transferases
• GO terms:
  • GO:0016758 - transferase activity, transferring hexosyl groups (Uniprot)
  • GO:0016757 - transferase activity, transferring glycosyl groups (Uniprot)
  • GO:0016740 - transferase activity (Uniprot)
  • GO:0009247 - glycolipid biosynthetic process (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
  • GDPFUC[c] + 3 SAM[c] + DTDP[c] + PHBAD1[c] -> SAH[c] + PHBAD2[c]
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure:
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020): (none with >35% aa id)
• Links to additional information on Rv2957:
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = 1.433 (from Jeremy Rock's lab)
  • KEGG - nucleotide and amino acid sequences of gene
  • Mycobrowser
  • PATRIC
  • BioCyc
  • Systems Biology

Amino Acid Sequence

MVQTKRYAGLTAANTKKVAMAAPMFSIIIPTLNVAAVLPACLDSIARQTCGDFELVLVDGGSTDETLDIANIFAPNLGERLIIHRDTDQGVYDAMNRGVD
LATGTWLLFLGADDSLYEADTLARVAAFIGEHEPSDLVYGDVIMRSTNFRWGGAFDLDRLLFKRNICHQAIFYRRGLFGTIGPYNLRYRVLADWDFNIRC
FSNPALVTRYMHVVVASYNEFGGLSNTIVDKEFLKRLPMSTRLGIRLVIVLVRRWPKVISRAMVMRTVISWRRRR

Additional Information