TB Genome Annotation Portal

Rv2945c (lppX)

Amino Acid Sequence

MNDGKRAVTSAVLVVLGACLALWLSGCSSPKPDAEEQGVPVSPTASDPALLAEIRQSLDATKGLTSVHVAVRTTGKVDSLLGITSADVDVRANPLAAKGV
CTYNDEQGVPFRVQGDNISVKLFDDWSNLGSISELSTSRVLDPAAGVTQLLSGVTNLQAQGTEVIDGISTTKITGTIPASSVKMLDPGAKSARPATVWIA
QDGSHHLVRASIDLGSGSIQLTQSKWNEPVNVD
(Nucleotide sequence available on KEGG)

Additional Information




Analysis of Positive Selection in Clinical Isolates *new*

Moldova (2,057)global set (5,195)
under significant positive selection?NONO
omega peak height (95%CI lower bound)2.41 (0.51)1.68 (0.64)
codons under selection
omega plots
genetic variantslinklink
statistics at each codonlinklink

ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across >100 conditions *new*

Classification Condition Strain Method Reference Notes
Non-Essential Sodium Oleate H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: 0.000000;
2 non-insertions in a row out of 10 sites
Non-Essential Lignoceric Acid H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: 0.000000;
1 non-insertions in a row out of 10 sites
Non-Essential Phosphatidylcholine H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: 0.000000;
1 non-insertions in a row out of 10 sites
Non-Essential minimal media + 0.1% glycerol H37RvMA Gumbel Griffin et al. (2011) Probability of Essentiality: 0.000000;
1 non-insertions in a row out of 11 sites
Non-Essential minimal media + 0.01% cholesterol H37RvMA Gumbel Griffin et al. (2011) Probability of Essentiality: 0.000000;
1 non-insertions in a row out of 11 sites
Non-Essential 7H10-glycerol H37RvMA TraSH Sassetti et al. (2003a)
Non-Essential C57BL/6J mice (8 weeks) H37RvMA TraSH Sassetti et al. (2003b) Hybridization Ratio: 1.22
Non-Essential 7H09/7H10 + rich media H37RvMA MotifHMM DeJesus et al. (2017) Fully saturated (14 reps).

TnSeq Data No data currently available.
  • No TnSeq data currently available for this Target.
RNASeq Data No data currently available.
  • No RNA-Seq data currently available for this Target.
Metabolomic Profiles No data currently available.
  • No Metabolomic data currently available for this Target.
Proteomic Data No data currently available.
  • No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology
  • BioCyc

    Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

    NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

    Interactions based on ChIPSeq data

  • Interactions based on ChIPSeq data (Minch et al. 2014)

    • Binds To:

      • No bindings to other targets were found.
    • Bound By:

    Interactions based on TFOE data (Rustad et al. 2014)



    TBCAP

    Tubculosis Community Annotation Project (
    Slayden et al., 2013)

    Rv2945c (lppX)

    PropertyValueCreatorEvidencePMIDComment
    CitationLppX is a lipoprotein required for the translocation of phthiocerol dimycocerosates to the surface of Mycobacterium tuberculosis. G. Sulzenbacher, S. Canaan et al. EMBO J. 2006njamshidiIDA16541102PMID: 16541102 - phthiocerol translocase
    TermTBRXN:PPDIMAT ppdima translocase - IDAnjamshidiIDA16541102PMID: 16541102 - phthiocerol translocase
    G. Sulzenbacher, S. Canaan et al. LppX is a lipoprotein required for the translocation of phthiocerol dimycocerosates to the surface of Mycobacterium tuberculosis. EMBO J. 2006
    TermTBRXN:PDIMAT pdima translocase - IDAnjamshidiIDA16541102PMID: 16541102 - phthiocerol translocase
    G. Sulzenbacher, S. Canaan et al. LppX is a lipoprotein required for the translocation of phthiocerol dimycocerosates to the surface of Mycobacterium tuberculosis. EMBO J. 2006
    CitationLppX is a lipoprotein required for the translocation of phthiocerol dimycocerosates to the surface of Mycobacterium tuberculosis. G. Sulzenbacher, S. Canaan et al. EMBO J. 2006njamshidiIDA16541102PMID: 16541102 - phthiocerol translocase
    NameLipoprotein involved in the transport of phthiocerol dimycocerosates to the cell surfacemjacksonIMPPhthiocerol dimycocerosates (PDIM), phenolic glycolipids (PGL) and para-hydroxybenzoic acid derivatives
    CitationLppX is a lipoprotein required for the translocation of phthiocerol dimycocerosates to the surface of Mycobacterium tuberculosis. G. Sulzenbacher, S. Canaan et al. EMBO J. 2006mjackson16541102Lipoprotein involved in the transport of phthiocerol dimycocerosates to the cell surface (phenotypic [mycobacterial recombinant strains])
    OtherTBPWY:Phthiocerol dimycocerosates, PGL & pHBADmjacksonLipoprotein involved in the transport of phthiocerol dimycocerosates to the cell surface (phenotypic [mycobacterial recombinant strains])
    G. Sulzenbacher, S. Canaan et al. LppX is a lipoprotein required for the translocation of phthiocerol dimycocerosates to the surface of Mycobacterium tuberculosis. EMBO J. 2006

    Comments