Rv2945c (lppX)

Current annotations:
- TBCAP: (community-based annotations - see table at bottom of page)
- TBDB: lipoprotein lPpx
- REFSEQ: lipoprotein LppX
- PATRIC: Putative lipoprotein LppX precursor
- TUBERCULIST: Probable conserved lipoprotein LppX
- NCBI: Probable conserved lipoprotein LppX
- updated information (H37Rv4):
  - gene name: lppX
  - function: apolipoprotein N-acyltransferase (aka 'lnt')
  - reference: Tschumi (2009) PMID: 19661058
Type: Conditional
Start: 3290624
End: 3291325
Operon:

Trans-membrane region:
Role: II.C.1 - Lipoproteins(lppA-lpr0)
GO terms:
- GO:0071770 - DIM/DIP cell wall layer assembly (Uniprot)
- GO:0044121 - growth of symbiont in host organelle (Uniprot)
- GO:0016020 - membrane (Uniprot)
- GO:0009986 - cell surface (Uniprot)
- GO:0009405 - pathogenesis (Uniprot)
- GO:0006869 - lipid transport (Uniprot)
- GO:0005886 - plasma membrane (Uniprot)
- GO:0005618 - cell wall (Uniprot)
- GO:0005576 - extracellular region (Uniprot)
- GO:0005319 - lipid transporter activity (Uniprot)
Reaction(s) (based on iSM810 metabolic model):
Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
Orthologs among selected mycobacteria
Protein structure: 2byo
Search for Homologs in PDB
Top 10 Homologs in PDB (as of Nov 2020):

PDB aa ident species PDB title

2BYO 100% MYCOBACTERIUM TUBERCULOSIS Crystal structure of Mycobacterium tuberculosis lipoprotein LppX (Rv2945c)
Links to additional information on lppX:
- TBDB (updated)
- Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
- UniProt
- AlphaFold model
- Vulnerability = 0.871 (from Jeremy Rock's lab)
- KEGG - nucleotide and amino acid sequences of gene
- Mycobrowser
- PATRIC
- BioCyc
- Systems Biology

PDB	aa ident	species	PDB title
2BYO	100%	MYCOBACTERIUM TUBERCULOSIS	Crystal structure of Mycobacterium tuberculosis lipoprotein LppX (Rv2945c)

Amino Acid Sequence

MNDGKRAVTSAVLVVLGACLALWLSGCSSPKPDAEEQGVPVSPTASDPALLAEIRQSLDATKGLTSVHVAVRTTGKVDSLLGITSADVDVRANPLAAKGV
CTYNDEQGVPFRVQGDNISVKLFDDWSNLGSISELSTSRVLDPAAGVTQLLSGVTNLQAQGTEVIDGISTTKITGTIPASSVKMLDPGAKSARPATVWIA
QDGSHHLVRASIDLGSGSIQLTQSKWNEPVNVD

(Nucleotide sequence available on KEGG)

Additional Information

ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across >100 conditions *new*

Classification	Condition	Strain	Method	Reference	Notes
Non-Essential	Sodium Oleate	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.000000; 2 non-insertions in a row out of 10 sites
Non-Essential	Lignoceric Acid	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.000000; 1 non-insertions in a row out of 10 sites
Non-Essential	Phosphatidylcholine	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.000000; 1 non-insertions in a row out of 10 sites
Non-Essential	minimal media + 0.1% glycerol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 0.000000; 1 non-insertions in a row out of 11 sites
Non-Essential	minimal media + 0.01% cholesterol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 0.000000; 1 non-insertions in a row out of 11 sites
Non-Essential	7H10-glycerol	H37RvMA	TraSH	Sassetti et al. (2003a)
Non-Essential	C57BL/6J mice (8 weeks)	H37RvMA	TraSH	Sassetti et al. (2003b)	Hybridization Ratio: 1.22
Non-Essential	7H09/7H10 + rich media	H37RvMA	MotifHMM	DeJesus et al. (2017)	Fully saturated (14 reps).

TnSeq Data No data currently available.

No TnSeq data currently available for this Target.

RNASeq Data No data currently available.

No RNA-Seq data currently available for this Target.

Metabolomic Profiles No data currently available.

No Metabolomic data currently available for this Target.

Proteomic Data No data currently available.

No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology

BioCyc

Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

Interactions based on ChIPSeq data

Binds To:
- No bindings to other targets were found.
Bound By:

Interactions based on ChIPSeq data (Minch et al. 2014)

Binds To:
- No bindings to other targets were found.
Bound By:
- Rv1353c (-) (Direct binding)
- Rv3736 (-) (Direct binding)

Interactions based on TFOE data (Rustad et al. 2014)

Upregulates:
- Does not upregulate other genes.
Upregulated by:
- Not upregulated by other genes.
Downregulates:
- Does not downregulate other genes.
Downregulated by:

Property	Value	Creator	Evidence	PMID	Comment
Citation	LppX is a lipoprotein required for the translocation of phthiocerol dimycocerosates to the surface of Mycobacterium tuberculosis. G. Sulzenbacher, S. Canaan et al. EMBO J. 2006	njamshidi	IDA	16541102	PMID: 16541102 - phthiocerol translocase
Term	TBRXN:PPDIMAT ppdima translocase - IDA	njamshidi	IDA	16541102	PMID: 16541102 - phthiocerol translocase G. Sulzenbacher, S. Canaan et al. LppX is a lipoprotein required for the translocation of phthiocerol dimycocerosates to the surface of Mycobacterium tuberculosis. EMBO J. 2006
Term	TBRXN:PDIMAT pdima translocase - IDA	njamshidi	IDA	16541102	PMID: 16541102 - phthiocerol translocase G. Sulzenbacher, S. Canaan et al. LppX is a lipoprotein required for the translocation of phthiocerol dimycocerosates to the surface of Mycobacterium tuberculosis. EMBO J. 2006
Citation	LppX is a lipoprotein required for the translocation of phthiocerol dimycocerosates to the surface of Mycobacterium tuberculosis. G. Sulzenbacher, S. Canaan et al. EMBO J. 2006	njamshidi	IDA	16541102	PMID: 16541102 - phthiocerol translocase
Name	Lipoprotein involved in the transport of phthiocerol dimycocerosates to the cell surface	mjackson	IMP		Phthiocerol dimycocerosates (PDIM), phenolic glycolipids (PGL) and para-hydroxybenzoic acid derivatives
Citation	LppX is a lipoprotein required for the translocation of phthiocerol dimycocerosates to the surface of Mycobacterium tuberculosis. G. Sulzenbacher, S. Canaan et al. EMBO J. 2006	mjackson		16541102	Lipoprotein involved in the transport of phthiocerol dimycocerosates to the cell surface (phenotypic [mycobacterial recombinant strains])
Other	TBPWY:Phthiocerol dimycocerosates, PGL & pHBAD	mjackson			Lipoprotein involved in the transport of phthiocerol dimycocerosates to the cell surface (phenotypic [mycobacterial recombinant strains]) G. Sulzenbacher, S. Canaan et al. LppX is a lipoprotein required for the translocation of phthiocerol dimycocerosates to the surface of Mycobacterium tuberculosis. EMBO J. 2006

TB Genome Annotation Portal