TB Genome Annotation Portal

Rv2941 (fadD28)

Amino Acid Sequence

MSVRSLPAALRACARLQPHDPAFTFMDYEQDWDGVAITLTWSQLYRRTLNVAQELSRCGSTGDRVVISAPQGLEYVVAFLGALQAGRIAVPLSVPQGGVT
DERSDSVLSDSSPVAILTTSSAVDDVVQHVARRPGESPPSIIEVDLLDLDAPNGYTFKEDEYPSTAYLQYTSGSTRTPAGVVMSHQNVRVNFEQLMSGYF
ADTDGIPPPNSALVSWLPFYHDMGLVIGICAPILGGYPAVLTSPVSFLQRPARWMHLMASDFHAFSAAPNFAFELAARRTTDDDMAGRDLGNILTILSGS
ERVQAATIKRFADRFARFNLQERVIRPSYGLAEATVYVATSKPGQPPETVDFDTESLSAGHAKPCAGGGATSLISYMLPRSPIVRIVDSDTCIECPDGTV
GEIWVHGDNVANGYWQKPDESERTFGGKIVTPSPGTPEGPWLRTGDSGFVTDGKMFIIGRIKDLLIVYGRNHSPDDIEATIQEITRGRCAAISVPGDRST
EKLVAIIELKKRGDSDQDAMARLGAIKREVTSALSSSHGLSVADLVLVAPGSIPITTSGKVRRGACVEQYRQDQFARLDA
(Nucleotide sequence available on KEGG)

Additional Information



ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across ~100 conditions

Rv2941/fadD28, gene len: 1742 bp, num TA sites: 47
conditiondatasetcallmediummethodnotes
in-vitroDeJesus 2017 mBionon-essential7H9HMMfully saturated, 14 TnSeq libraries combined
in-vitroSassetti 2003 Mol Microno data 7H9TRASHessential if hybridization ratio<0.2
in-vivo (mice)Sassetti 2003 PNASno data BL6 miceTRASHessential if hybridization ratio<0.4, min over 4 timepoints (1-8 weeks)
in-vitro (glycerol)Griffin 2011 PPathnon-essentialM9 minimal+glycerolGumbel2 replicates; Padj<0.05
in-vitro (cholesterol)Griffin 2011 PPathnon-essentialM9 minimal+cholesterolGumbel3 replicates; Padj<0.05
differentially essential in cholesterol Griffin 2011 PPathNO (LFC=0.22)cholesterol vs glycerolresampling-SRYES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in cholesterol
in-vitroSmith 2022 eLifenon-essential7H9HMM6 replicates (raw data in Subramaniam 2017, PMID 31752678)
in-vivo (mice)Smith 2022 eLifenon-essentialBL6 miceHMM6 replicates (raw data in Subramaniam 2017, PMID 31752678)
differentially essential in miceSmith 2022 eLifeYES (LFC=0.935)in-vivo vs in-vitroZINBYES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in mice
in-vitro (minimal)Minato 2019 mSysnon-essentialminimal mediumHMM
in-vitro (YM rich medium)Minato 2019 mSysnon-essentialYM rich mediumHMM7H9 supplemented with ~20 metabolites (amino acids, cofactors)
differentially essential in YM rich mediumMinato 2019 mSysNO (LFC=0.81)YM rich vs minimal mediumresampling

Analysis of Positive Selection in Clinical Isolates *new*

global set of 10,626 Mtb clinical isolates
under significant positive selection?NO
omega peak height (95%CI lower bound)1.69 (0.77)
codons under selection
omega plotsomega plot across ORF
genetic variants*link
* example format for variants: "D27 (GAC): D27H (CAC,11)" means "Asp27 (native codon GAC) mutated to His (codon CAC) in 11 isolates"



TnSeq Data No data currently available.
  • No TnSeq data currently available for this Target.
RNASeq Data No data currently available.
  • No RNA-Seq data currently available for this Target.
Metabolomic Profiles No data currently available.
  • No Metabolomic data currently available for this Target.
Proteomic Data No data currently available.
  • No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology
  • BioCyc

    Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

    NOTE: see table of TFOE interactions below

    Interactions based on ChIPSeq data

    RNA processing and modification
    Energy production and conversion
    Chromatin structure and dynamics
    Amino acid transport and metabolism
    Cell cycle control, cell division, chromosome partitioning
    Carbohydrate transport and metabolism
    Nucleotide transport and metabolism
    Lipid transport and metabolism
    Coenzyme transport and metabolism
    Transcription
    Translation, ribosomal structure and biogenesis
    Cell wall/membrane/envelope biogenesis
    Replication, recombination and repair
    Posttranslational modification, protein turnover, chaperones
    Cell motility
    Secondary metabolites biosynthesis, transport and catabolism
    Inorganic ion transport and metabolism
    Function unknown
    General function prediction only
    Intracellular trafficking, secretion, and vesicular transport
    Signal transduction mechanisms
    Extracellular structures
    Defense mechanisms
    Nuclear structure
    Cytoskeleton
  • BioCyc Co-regulated genes based on gene expression profiling (Systems Biology, Inferelator Network)
  • Differentially expressed as result of RNASeq in glycerol environment (Only top 20 genes shown sorted by log fold change with p_adj 0.05).
    Conditionally essential as result of TNSeq (Only top 20 genes shown sorted by log fold change with p_adj 0.05).
  • BioCyc Transcription factor binding based on ChIP-Seq (Systems Biology)
  • Interactions based on ChIPSeq data (Minch et al. 2014)

    Interactions based on TFOE data (Rustad et al. 2014)

    TFOE = Transcription Factor Over-Expression study
    significance criteria used in paper: greater than 2-fold change (|LFC|>=1.0) and Padj<0.01

    no significant interactions found



    TBCAP

    Tubculosis Community Annotation Project (
    Slayden et al., 2013)

    Rv2941 (fadD28)

    PropertyValueCreatorEvidencePMIDComment
    TermTBRXN:PPDIMAS PPDIM synthesis (Mycobacterium Tuberculosis) - IPInjamshidiIPI12031661Actually a fatty acyl co-ligase, however condensation reaction is using free forms of fatty-acids or phthiocerol. see PMID: 12031661 and Cole et al Tuberculosis and the Tubercle Bacillus text, also PMID 15292272. PMID: 12730158 starts to elucidate which genes may be involved, but not yet definitively associated genes with the pathways leading up to pdima synthesis.
    E. Prez, P. Constant et al. Characterization of three glycosyltransferases involved in the biosynthesis of the phenolic glycolipid antigens from the Mycobacterium tuberculosis complex. J. Biol. Chem. 2004
    CitationAttenuation of Mycobacterium tuberculosis by disruption of a mas-like gene or a chalcone synthase-like gene, which causes deficiency in dimycocerosyl phthiocerol synthesis. TD. Sirakova, VS. Dubey et al. J. Bacteriol. 2003njamshidiIPI12031661|12730158Actually a fatty acyl co-ligase, however condensation reaction is using free forms of fatty-acids or phthiocerol. see PMID: 12031661 and Cole et al Tuberculosis and the Tubercle Bacillus text, also PMID 15292272. PMID: 12730158 starts to elucidate which genes may be involved, but not yet definitively associated genes with the pathways leading up to pdima synthesis.
    TermTBRXN:PPDIMAS PPDIM synthesis (Mycobacterium Tuberculosis) - IPInjamshidiIPI12031661Actually a fatty acyl co-ligase, however condensation reaction is using free forms of fatty-acids or phthiocerol. see PMID: 12031661 and Cole et al Tuberculosis and the Tubercle Bacillus text, also PMID 15292272. PMID: 12730158 starts to elucidate which genes may be involved, but not yet definitively associated genes with the pathways leading up to pdima synthesis.
    TD. Sirakova, VS. Dubey et al. Attenuation of Mycobacterium tuberculosis by disruption of a mas-like gene or a chalcone synthase-like gene, which causes deficiency in dimycocerosyl phthiocerol synthesis. J. Bacteriol. 2003
    TermTBRXN:PPDIMAS PPDIM synthesis (Mycobacterium Tuberculosis) - ISSnjamshidiISS12031661Actually a fatty acyl co-ligase, however condensation reaction is using free forms of fatty-acids or phthiocerol. see PMID: 12031661 and Cole et al Tuberculosis and the Tubercle Bacillus text, also PMID 15292272. PMID: 12730158 starts to elucidate which genes may be involved, but not yet definitively associated genes with the pathways leading up to pdima synthesis.
    authors,DE. Minnikin,L. Kremer,LG. Dover,GS. Besra The methyl-branched fortifications of Mycobacterium tuberculosis. Chem. Biol. 2002
    CitationCharacterization of three glycosyltransferases involved in the biosynthesis of the phenolic glycolipid antigens from the Mycobacterium tuberculosis complex. E. Prez, P. Constant et al. J. Biol. Chem. 2004njamshidiISS12031661|15292272Actually a fatty acyl co-ligase, however condensation reaction is using free forms of fatty-acids or phthiocerol. see PMID: 12031661 and Cole et al Tuberculosis and the Tubercle Bacillus text, also PMID 15292272. PMID: 12730158 starts to elucidate which genes may be involved, but not yet definitively associated genes with the pathways leading up to pdima synthesis.
    TermTBRXN:PPDIMAS PPDIM synthesis (Mycobacterium Tuberculosis) - ISSnjamshidiISS12031661Actually a fatty acyl co-ligase, however condensation reaction is using free forms of fatty-acids or phthiocerol. see PMID: 12031661 and Cole et al Tuberculosis and the Tubercle Bacillus text, also PMID 15292272. PMID: 12730158 starts to elucidate which genes may be involved, but not yet definitively associated genes with the pathways leading up to pdima synthesis.
    E. Prez, P. Constant et al. Characterization of three glycosyltransferases involved in the biosynthesis of the phenolic glycolipid antigens from the Mycobacterium tuberculosis complex. J. Biol. Chem. 2004
    CitationAttenuation of Mycobacterium tuberculosis by disruption of a mas-like gene or a chalcone synthase-like gene, which causes deficiency in dimycocerosyl phthiocerol synthesis. TD. Sirakova, VS. Dubey et al. J. Bacteriol. 2003njamshidiISS12031661|12730158Actually a fatty acyl co-ligase, however condensation reaction is using free forms of fatty-acids or phthiocerol. see PMID: 12031661 and Cole et al Tuberculosis and the Tubercle Bacillus text, also PMID 15292272. PMID: 12730158 starts to elucidate which genes may be involved, but not yet definitively associated genes with the pathways leading up to pdima synthesis.
    TermTBRXN:PPDIMAS PPDIM synthesis (Mycobacterium Tuberculosis) - ISSnjamshidiISS12031661Actually a fatty acyl co-ligase, however condensation reaction is using free forms of fatty-acids or phthiocerol. see PMID: 12031661 and Cole et al Tuberculosis and the Tubercle Bacillus text, also PMID 15292272. PMID: 12730158 starts to elucidate which genes may be involved, but not yet definitively associated genes with the pathways leading up to pdima synthesis.
    TD. Sirakova, VS. Dubey et al. Attenuation of Mycobacterium tuberculosis by disruption of a mas-like gene or a chalcone synthase-like gene, which causes deficiency in dimycocerosyl phthiocerol synthesis. J. Bacteriol. 2003
    CitationThe methyl-branched fortifications of Mycobacterium tuberculosis. authors,DE. Minnikin,L. Kremer,LG. Dover,GS. Besra Chem. Biol. 2002njamshidiIPI12031661Actually a fatty acyl co-ligase, however condensation reaction is using free forms of fatty-acids or phthiocerol. see PMID: 12031661 and Cole et al Tuberculosis and the Tubercle Bacillus text, also PMID 15292272. PMID: 12730158 starts to elucidate which genes may be involved, but not yet definitively associated genes with the pathways leading up to pdima synthesis.
    TermTBRXN:PPDIMAS PPDIM synthesis (Mycobacterium Tuberculosis) - IPInjamshidiIPI12031661Actually a fatty acyl co-ligase, however condensation reaction is using free forms of fatty-acids or phthiocerol. see PMID: 12031661 and Cole et al Tuberculosis and the Tubercle Bacillus text, also PMID 15292272. PMID: 12730158 starts to elucidate which genes may be involved, but not yet definitively associated genes with the pathways leading up to pdima synthesis.
    authors,DE. Minnikin,L. Kremer,LG. Dover,GS. Besra The methyl-branched fortifications of Mycobacterium tuberculosis. Chem. Biol. 2002
    CitationCharacterization of three glycosyltransferases involved in the biosynthesis of the phenolic glycolipid antigens from the Mycobacterium tuberculosis complex. E. Prez, P. Constant et al. J. Biol. Chem. 2004njamshidiIPI12031661|15292272Actually a fatty acyl co-ligase, however condensation reaction is using free forms of fatty-acids or phthiocerol. see PMID: 12031661 and Cole et al Tuberculosis and the Tubercle Bacillus text, also PMID 15292272. PMID: 12730158 starts to elucidate which genes may be involved, but not yet definitively associated genes with the pathways leading up to pdima synthesis.
    CitationThe methyl-branched fortifications of Mycobacterium tuberculosis. authors,DE. Minnikin,L. Kremer,LG. Dover,GS. Besra Chem. Biol. 2002njamshidiISS12031661Actually a fatty acyl co-ligase, however condensation reaction is using free forms of fatty-acids or phthiocerol. see PMID: 12031661 and Cole et al Tuberculosis and the Tubercle Bacillus text, also PMID 15292272. PMID: 12730158 starts to elucidate which genes may be involved, but not yet definitively associated genes with the pathways leading up to pdima synthesis.
    CitationThe methyl-branched fortifications of Mycobacterium tuberculosis. authors,DE. Minnikin,L. Kremer,LG. Dover,GS. Besra Chem. Biol. 2002njamshidiISS12031661Actually a fatty acyl co-ligase, however condensation reaction is using free forms of fatty-acids or phthiocerol. see PMID: 12031661 and Cole et al Tuberculosis and the Tubercle Bacillus text. PMID: 12730158 starts to elucidate which genes may be involved, but not yet definitively associated genes with the pathways leading up to pdima synthesis.
    TermTBRXN:PDIMAS PDIM A synthesis (Mycobacterium Tuberculosis) - ISSnjamshidiISS12031661Actually a fatty acyl co-ligase, however condensation reaction is using free forms of fatty-acids or phthiocerol. see PMID: 12031661 and Cole et al Tuberculosis and the Tubercle Bacillus text. PMID: 12730158 starts to elucidate which genes may be involved, but not yet definitively associated genes with the pathways leading up to pdima synthesis.
    authors,DE. Minnikin,L. Kremer,LG. Dover,GS. Besra The methyl-branched fortifications of Mycobacterium tuberculosis. Chem. Biol. 2002
    CitationAttenuation of Mycobacterium tuberculosis by disruption of a mas-like gene or a chalcone synthase-like gene, which causes deficiency in dimycocerosyl phthiocerol synthesis. TD. Sirakova, VS. Dubey et al. J. Bacteriol. 2003njamshidiISS12031661|12730158Actually a fatty acyl co-ligase, however condensation reaction is using free forms of fatty-acids or phthiocerol. see PMID: 12031661 and Cole et al Tuberculosis and the Tubercle Bacillus text. PMID: 12730158 starts to elucidate which genes may be involved, but not yet definitively associated genes with the pathways leading up to pdima synthesis.
    TermTBRXN:PDIMAS PDIM A synthesis (Mycobacterium Tuberculosis) - ISSnjamshidiISS12031661Actually a fatty acyl co-ligase, however condensation reaction is using free forms of fatty-acids or phthiocerol. see PMID: 12031661 and Cole et al Tuberculosis and the Tubercle Bacillus text. PMID: 12730158 starts to elucidate which genes may be involved, but not yet definitively associated genes with the pathways leading up to pdima synthesis.
    TD. Sirakova, VS. Dubey et al. Attenuation of Mycobacterium tuberculosis by disruption of a mas-like gene or a chalcone synthase-like gene, which causes deficiency in dimycocerosyl phthiocerol synthesis. J. Bacteriol. 2003
    CitationThe methyl-branched fortifications of Mycobacterium tuberculosis. authors,DE. Minnikin,L. Kremer,LG. Dover,GS. Besra Chem. Biol. 2002njamshidiIPI12031661Actually a fatty acyl co-ligase, however condensation reaction is using free forms of fatty-acids or phthiocerol. see PMID: 12031661 and Cole et al Tuberculosis and the Tubercle Bacillus text. PMID: 12730158 starts to elucidate which genes may be involved, but not yet definitively associated genes with the pathways leading up to pdima synthesis.
    TermTBRXN:PDIMAS PDIM A synthesis (Mycobacterium Tuberculosis) - IPInjamshidiIPI12031661Actually a fatty acyl co-ligase, however condensation reaction is using free forms of fatty-acids or phthiocerol. see PMID: 12031661 and Cole et al Tuberculosis and the Tubercle Bacillus text. PMID: 12730158 starts to elucidate which genes may be involved, but not yet definitively associated genes with the pathways leading up to pdima synthesis.
    authors,DE. Minnikin,L. Kremer,LG. Dover,GS. Besra The methyl-branched fortifications of Mycobacterium tuberculosis. Chem. Biol. 2002
    CitationAttenuation of Mycobacterium tuberculosis by disruption of a mas-like gene or a chalcone synthase-like gene, which causes deficiency in dimycocerosyl phthiocerol synthesis. TD. Sirakova, VS. Dubey et al. J. Bacteriol. 2003njamshidiIPI12031661|12730158Actually a fatty acyl co-ligase, however condensation reaction is using free forms of fatty-acids or phthiocerol. see PMID: 12031661 and Cole et al Tuberculosis and the Tubercle Bacillus text. PMID: 12730158 starts to elucidate which genes may be involved, but not yet definitively associated genes with the pathways leading up to pdima synthesis.
    TermTBRXN:PDIMAS PDIM A synthesis (Mycobacterium Tuberculosis) - IPInjamshidiIPI12031661Actually a fatty acyl co-ligase, however condensation reaction is using free forms of fatty-acids or phthiocerol. see PMID: 12031661 and Cole et al Tuberculosis and the Tubercle Bacillus text. PMID: 12730158 starts to elucidate which genes may be involved, but not yet definitively associated genes with the pathways leading up to pdima synthesis.
    TD. Sirakova, VS. Dubey et al. Attenuation of Mycobacterium tuberculosis by disruption of a mas-like gene or a chalcone synthase-like gene, which causes deficiency in dimycocerosyl phthiocerol synthesis. J. Bacteriol. 2003
    InteractionPhysicalInteraction Rv2940cshahanup86IMPAffinity purification (Physical interaction)
    AM. Fitzmaurice & PE. Kolattukudy An acyl-CoA synthase (acoas) gene adjacent to the mycocerosic acid synthase (mas) locus is necessary for mycocerosyl lipid synthesis in Mycobacterium tuberculosis var. bovis BCG. J. Biol. Chem. 1998
    InteractionRegulatedBy Rv1221yamir.morenoIEPMicroarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
    R. Manganelli, MI. Voskuil et al. The Mycobacterium tuberculosis ECF sigma factor sigmaE: role in global gene expression and survival in macrophages. Mol. Microbiol. 2001
    NameLong chain fatty acyl-AMP ligase responsible for providing the long-chain fatty acid starter unit to Mas for the generation of mycocerosic acidsmjacksonIMPPhthiocerol dimycocerosates (PDIM), phenolic glycolipids (PGL) and para-hydroxybenzoic acid derivatives
    NameLong chain fatty acyl-AMP ligase responsible for providing the long-chain fatty acid starter unit to Mas for the generation of mycocerosic acidsmjacksonIDAPhthiocerol dimycocerosates (PDIM), phenolic glycolipids (PGL) and para-hydroxybenzoic acid derivatives
    CitationOpen reading frame 3, which is adjacent to the mycocerosic acid synthase gene, is expressed as an acyl coenzyme A synthase in Mycobacterium bovis BCG. authors,AM. Fitzmaurice,PE. Kolattukudy J. Bacteriol. 1997mjackson9098059Long chain fatty acyl-AMP ligase responsible for providing the long-chain fatty acid starter unit to Mas for the generation of mycocerosic acids (phenotypic [mycobacterial recombinant strains]; enzymatic)
    OtherTBPWY:Phthiocerol dimycocerosates, PGL & pHBADmjacksonLong chain fatty acyl-AMP ligase responsible for providing the long-chain fatty acid starter unit to Mas for the generation of mycocerosic acids (phenotypic [mycobacterial recombinant strains]; enzymatic)
    authors,AM. Fitzmaurice,PE. Kolattukudy Open reading frame 3, which is adjacent to the mycocerosic acid synthase gene, is expressed as an acyl coenzyme A synthase in Mycobacterium bovis BCG. J. Bacteriol. 1997
    CitationAn acyl-CoA synthase (acoas) gene adjacent to the mycocerosic acid synthase (mas) locus is necessary for mycocerosyl lipid synthesis in Mycobacterium tuberculosis var. bovis BCG. AM. Fitzmaurice & PE. Kolattukudy J. Biol. Chem. 1998mjackson9525903Long chain fatty acyl-AMP ligase responsible for providing the long-chain fatty acid starter unit to Mas for the generation of mycocerosic acids (phenotypic [mycobacterial recombinant strains]; enzymatic)
    OtherTBPWY:Phthiocerol dimycocerosates, PGL & pHBADmjacksonLong chain fatty acyl-AMP ligase responsible for providing the long-chain fatty acid starter unit to Mas for the generation of mycocerosic acids (phenotypic [mycobacterial recombinant strains]; enzymatic)
    AM. Fitzmaurice & PE. Kolattukudy An acyl-CoA synthase (acoas) gene adjacent to the mycocerosic acid synthase (mas) locus is necessary for mycocerosyl lipid synthesis in Mycobacterium tuberculosis var. bovis BCG. J. Biol. Chem. 1998
    CitationComplex lipid determines tissue-specific replication of Mycobacterium tuberculosis in mice. authors,JS. Cox,B. Chen,M. McNeil,WR. Jacobs Nature 1999mjackson10573420Long chain fatty acyl-AMP ligase responsible for providing the long-chain fatty acid starter unit to Mas for the generation of mycocerosic acids (phenotypic [mycobacterial recombinant strains]; enzymatic)
    OtherTBPWY:Phthiocerol dimycocerosates, PGL & pHBADmjacksonLong chain fatty acyl-AMP ligase responsible for providing the long-chain fatty acid starter unit to Mas for the generation of mycocerosic acids (phenotypic [mycobacterial recombinant strains]; enzymatic)
    authors,JS. Cox,B. Chen,M. McNeil,WR. Jacobs Complex lipid determines tissue-specific replication of Mycobacterium tuberculosis in mice. Nature 1999
    CitationAnalysis of the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. Evidence that this lipid is involved in the cell wall permeability barrier. LR. Camacho, P. Constant et al. J. Biol. Chem. 2001mjackson11279114Long chain fatty acyl-AMP ligase responsible for providing the long-chain fatty acid starter unit to Mas for the generation of mycocerosic acids (phenotypic [mycobacterial recombinant strains]; enzymatic)
    OtherTBPWY:Phthiocerol dimycocerosates, PGL & pHBADmjacksonLong chain fatty acyl-AMP ligase responsible for providing the long-chain fatty acid starter unit to Mas for the generation of mycocerosic acids (phenotypic [mycobacterial recombinant strains]; enzymatic)
    LR. Camacho, P. Constant et al. Analysis of the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. Evidence that this lipid is involved in the cell wall permeability barrier. J. Biol. Chem. 2001
    CitationEnzymic activation and transfer of fatty acids as acyl-adenylates in mycobacteria. OA. Trivedi,P. Arora,V. Sridharan,R. Tickoo,D. Mohanty,RS. Gokhale Nature 2004mjackson15042094Long chain fatty acyl-AMP ligase responsible for providing the long-chain fatty acid starter unit to Mas for the generation of mycocerosic acids (phenotypic [mycobacterial recombinant strains]; enzymatic)
    OtherTBPWY:Phthiocerol dimycocerosates, PGL & pHBADmjacksonLong chain fatty acyl-AMP ligase responsible for providing the long-chain fatty acid starter unit to Mas for the generation of mycocerosic acids (phenotypic [mycobacterial recombinant strains]; enzymatic)
    OA. Trivedi,P. Arora,V. Sridharan,R. Tickoo,D. Mohanty,RS. Gokhale Enzymic activation and transfer of fatty acids as acyl-adenylates in mycobacteria. Nature 2004
    CitationRole of the pks15/1 gene in the biosynthesis of phenolglycolipids in the Mycobacterium tuberculosis complex. Evidence that all strains synthesize glycosylated p-hydroxybenzoic methyl esters and that strains devoid of phenolglycolipids harbor a frameshift mutation in the pks15/1 gene. P. Constant, E. Perez et al. J. Biol. Chem. 2002jjmcfadden12138124Inferred from direct assay
    TermEC:6.2.1.- Ligases. Forming carbon-sulfur bonds. Acid--thiol ligases. - NRjjmcfaddenNRInferred from direct assay
    P. Constant, E. Perez et al. Role of the pks15/1 gene in the biosynthesis of phenolglycolipids in the Mycobacterium tuberculosis complex. Evidence that all strains synthesize glycosylated p-hydroxybenzoic methyl esters and that strains devoid of phenolglycolipids harbor a frameshift mutation in the pks15/1 gene. J. Biol. Chem. 2002
    TermEC:6.2.1.3 Long-chain-fatty-acid--CoA ligase. - NRjjmcfaddenNRInferred from direct assay
    P. Constant, E. Perez et al. Role of the pks15/1 gene in the biosynthesis of phenolglycolipids in the Mycobacterium tuberculosis complex. Evidence that all strains synthesize glycosylated p-hydroxybenzoic methyl esters and that strains devoid of phenolglycolipids harbor a frameshift mutation in the pks15/1 gene. J. Biol. Chem. 2002

    Comments