TB Genome Annotation Portal

Rv2941 (fadD28)

Amino Acid Sequence

MSVRSLPAALRACARLQPHDPAFTFMDYEQDWDGVAITLTWSQLYRRTLNVAQELSRCGSTGDRVVISAPQGLEYVVAFLGALQAGRIAVPLSVPQGGVT
DERSDSVLSDSSPVAILTTSSAVDDVVQHVARRPGESPPSIIEVDLLDLDAPNGYTFKEDEYPSTAYLQYTSGSTRTPAGVVMSHQNVRVNFEQLMSGYF
ADTDGIPPPNSALVSWLPFYHDMGLVIGICAPILGGYPAVLTSPVSFLQRPARWMHLMASDFHAFSAAPNFAFELAARRTTDDDMAGRDLGNILTILSGS
ERVQAATIKRFADRFARFNLQERVIRPSYGLAEATVYVATSKPGQPPETVDFDTESLSAGHAKPCAGGGATSLISYMLPRSPIVRIVDSDTCIECPDGTV
GEIWVHGDNVANGYWQKPDESERTFGGKIVTPSPGTPEGPWLRTGDSGFVTDGKMFIIGRIKDLLIVYGRNHSPDDIEATIQEITRGRCAAISVPGDRST
EKLVAIIELKKRGDSDQDAMARLGAIKREVTSALSSSHGLSVADLVLVAPGSIPITTSGKVRRGACVEQYRQDQFARLDA
(Nucleotide sequence available on KEGG)

Additional Information


















    ESSENTIALITY 

    







    



MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb


TnSeqCorr - genes with correlated TnSeq profiles across >100 conditions *new*



        

        
 Classification Condition Strain Method Reference Notes 


            

                Non-Essential
                Sodium Oleate
                H37RvMA

                    Gumbel



                    Subhalaxmi Nambi


                Probability of Essentiality: 0.000000;
3 non-insertions in a row out of 46 sites		
            



            

                Non-Essential
                Lignoceric Acid
                H37RvMA

                    Gumbel



                    Subhalaxmi Nambi


                Probability of Essentiality: 0.000000;
3 non-insertions in a row out of 46 sites		
            



            

                Non-Essential
                Phosphatidylcholine
                H37RvMA

                    Gumbel



                    Subhalaxmi Nambi


                Probability of Essentiality: 0.000000;
3 non-insertions in a row out of 46 sites		
            



            

                Non-Essential
                minimal media + 0.1% glycerol
                H37RvMA

                    Gumbel



                    Griffin et al. (2011)


                Probability of Essentiality: 0.000000;
4 non-insertions in a row out of 47 sites		
            



            

                Non-Essential
                minimal media + 0.01% cholesterol
                H37RvMA

                    Gumbel



                    Griffin et al. (2011)


                Probability of Essentiality: 0.000000;
4 non-insertions in a row out of 47 sites		
            



            

                No-Data
                7H10-glycerol
                H37RvMA

                    TraSH



                    Sassetti et al. (2003a)


                 
            



            

                Too-Short
                C57BL/6J mice (8 weeks)
                H37RvMA

                    TraSH



                    Sassetti et al. (2003b)


                Hybridization Ratio: -1
            



            

                Non-Essential
                7H09/7H10 + rich media
                H37RvMA

                    MotifHMM



                    DeJesus et al. (2017)


                Fully saturated (14 reps).
            



        



    












 





    TnSeq Data    No data currently available.

    




    



        
  •  No TnSeq data currently available for this Target.



















    RNASeq Data   No data currently available.

    





    



        
  •  No RNA-Seq data currently available for this Target.




















    Metabolomic Profiles    No data currently available.

    





    




        
  •  No Metabolomic data currently available for this Target.




















    Proteomic Data   No data currently available. 

    






    



        
  •  No Proteomic data currently available for this Target.


















 





    Regulatory Relationships from Systems Biology 

    




    






                
  • BioCyc


    Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)
    

    NOTE: 
    Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.




    Interactions based on ChIPSeq data
    


    

    

    

    
    


                
    
                    
    
                    RNA processing and modification
                
    

                
    
                    
    
                    Energy production and conversion
                
    

                
    
                    
    
                    Chromatin structure and dynamics
                
    

                
    
                    
    
                    Amino acid transport and metabolism
                
    

                
    
                    
    
                    Cell cycle control, cell division, chromosome partitioning
                
    

                
    
                    
    
                    Carbohydrate transport and metabolism
                
    

                
    
                    
    
                    Nucleotide transport and metabolism
                
    

                
    
                    
    
                    Lipid transport and metabolism
                
    

                
    
                    
    
                    Coenzyme transport and metabolism
                
    

                
    
                    
    
                    Transcription
                
    

                
    
                    
    
                    Translation, ribosomal structure and biogenesis
                
    

                
    
                    
    
                    Cell wall/membrane/envelope biogenesis
                
    

                
    
                    
    
                    Replication, recombination and repair
                
    

                
    
                    
    
                    Posttranslational modification, protein turnover, chaperones
                
    

                
    
                    
    
                    Cell motility
                
    

                
    
                    
    
                    Secondary metabolites biosynthesis, transport and catabolism
                
    

                
    
                    
    
                    Inorganic ion transport and metabolism
                
    

                
    
                    
    
                    Function unknown
                
    

                
    
                    
    
                    General function prediction only
                
    

                
    
                    
    
                    Intracellular trafficking, secretion, and vesicular transport
                
    

                
    
                    
    
                    Signal transduction mechanisms
                
    

                
    
                    
    
                    Extracellular structures
                
    

                
    
                    
    
                    Defense mechanisms
                
    

                
    
                    
    
                    Nuclear structure
                
    

                
    
                    
    
                    Cytoskeleton
                
    


    
    
    
  • BioCyc

                    Co-regulated genes based on gene expression profiling (Systems Biology, Inferelator Network)
                
    • 

                
    
                    
                    Differentially expressed as result of RNASeq in glycerol environment (Only top 20 genes shown sorted by log fold change with p_adj 0.05). 
                
    

                
    
                    
                    Conditionally essential as result of TNSeq (Only top 20 genes shown sorted by log fold change with p_adj 0.05). 
                
    

                
    
                    
                
  • BioCyc

                    Transcription factor binding based on ChIP-Seq (Systems Biology)
                
    • 


    
    

    






    Interactions based on ChIPSeq data (Minch et al. 2014)
    




    Interactions based on TFOE data (Rustad et al. 2014)
    














    







    




    


    TBCAP
    
Tubculosis Community Annotation Project (    Slayden et al., 2013)
    
Rv2941 (fadD28)

    

    PropertyValueCreatorEvidencePMIDComment
    
TermTBRXN:PPDIMAS PPDIM synthesis (Mycobacterium Tuberculosis) - IPInjamshidiIPI12031661Actually a fatty acyl co-ligase, however condensation reaction is using free forms of fatty-acids or phthiocerol. see PMID: 12031661 and Cole et al Tuberculosis and the Tubercle Bacillus text, also PMID 15292272. PMID: 12730158 starts to elucidate which genes may be involved, but not yet definitively associated genes with the pathways leading up to pdima synthesis.
    E. Prez, P. Constant et al. Characterization of three glycosyltransferases involved in the biosynthesis of the phenolic glycolipid antigens from the Mycobacterium tuberculosis complex. J. Biol. Chem. 2004
    
CitationAttenuation of Mycobacterium tuberculosis by disruption of a mas-like gene or a chalcone synthase-like gene, which causes deficiency in dimycocerosyl phthiocerol synthesis. TD. Sirakova, VS. Dubey et al. J. Bacteriol. 2003njamshidiIPI12031661|12730158Actually a fatty acyl co-ligase, however condensation reaction is using free forms of fatty-acids or phthiocerol. see PMID: 12031661 and Cole et al Tuberculosis and the Tubercle Bacillus text, also PMID 15292272. PMID: 12730158 starts to elucidate which genes may be involved, but not yet definitively associated genes with the pathways leading up to pdima synthesis.
    
TermTBRXN:PPDIMAS PPDIM synthesis (Mycobacterium Tuberculosis) - IPInjamshidiIPI12031661Actually a fatty acyl co-ligase, however condensation reaction is using free forms of fatty-acids or phthiocerol. see PMID: 12031661 and Cole et al Tuberculosis and the Tubercle Bacillus text, also PMID 15292272. PMID: 12730158 starts to elucidate which genes may be involved, but not yet definitively associated genes with the pathways leading up to pdima synthesis.
    TD. Sirakova, VS. Dubey et al. Attenuation of Mycobacterium tuberculosis by disruption of a mas-like gene or a chalcone synthase-like gene, which causes deficiency in dimycocerosyl phthiocerol synthesis. J. Bacteriol. 2003
    
TermTBRXN:PPDIMAS PPDIM synthesis (Mycobacterium Tuberculosis) - ISSnjamshidiISS12031661Actually a fatty acyl co-ligase, however condensation reaction is using free forms of fatty-acids or phthiocerol. see PMID: 12031661 and Cole et al Tuberculosis and the Tubercle Bacillus text, also PMID 15292272. PMID: 12730158 starts to elucidate which genes may be involved, but not yet definitively associated genes with the pathways leading up to pdima synthesis.
    authors,DE. Minnikin,L. Kremer,LG. Dover,GS. Besra The methyl-branched fortifications of Mycobacterium tuberculosis. Chem. Biol. 2002
    
CitationCharacterization of three glycosyltransferases involved in the biosynthesis of the phenolic glycolipid antigens from the Mycobacterium tuberculosis complex. E. Prez, P. Constant et al. J. Biol. Chem. 2004njamshidiISS12031661|15292272Actually a fatty acyl co-ligase, however condensation reaction is using free forms of fatty-acids or phthiocerol. see PMID: 12031661 and Cole et al Tuberculosis and the Tubercle Bacillus text, also PMID 15292272. PMID: 12730158 starts to elucidate which genes may be involved, but not yet definitively associated genes with the pathways leading up to pdima synthesis.
    
TermTBRXN:PPDIMAS PPDIM synthesis (Mycobacterium Tuberculosis) - ISSnjamshidiISS12031661Actually a fatty acyl co-ligase, however condensation reaction is using free forms of fatty-acids or phthiocerol. see PMID: 12031661 and Cole et al Tuberculosis and the Tubercle Bacillus text, also PMID 15292272. PMID: 12730158 starts to elucidate which genes may be involved, but not yet definitively associated genes with the pathways leading up to pdima synthesis.
    E. Prez, P. Constant et al. Characterization of three glycosyltransferases involved in the biosynthesis of the phenolic glycolipid antigens from the Mycobacterium tuberculosis complex. J. Biol. Chem. 2004
    
CitationAttenuation of Mycobacterium tuberculosis by disruption of a mas-like gene or a chalcone synthase-like gene, which causes deficiency in dimycocerosyl phthiocerol synthesis. TD. Sirakova, VS. Dubey et al. J. Bacteriol. 2003njamshidiISS12031661|12730158Actually a fatty acyl co-ligase, however condensation reaction is using free forms of fatty-acids or phthiocerol. see PMID: 12031661 and Cole et al Tuberculosis and the Tubercle Bacillus text, also PMID 15292272. PMID: 12730158 starts to elucidate which genes may be involved, but not yet definitively associated genes with the pathways leading up to pdima synthesis.
    
TermTBRXN:PPDIMAS PPDIM synthesis (Mycobacterium Tuberculosis) - ISSnjamshidiISS12031661Actually a fatty acyl co-ligase, however condensation reaction is using free forms of fatty-acids or phthiocerol. see PMID: 12031661 and Cole et al Tuberculosis and the Tubercle Bacillus text, also PMID 15292272. PMID: 12730158 starts to elucidate which genes may be involved, but not yet definitively associated genes with the pathways leading up to pdima synthesis.
    TD. Sirakova, VS. Dubey et al. Attenuation of Mycobacterium tuberculosis by disruption of a mas-like gene or a chalcone synthase-like gene, which causes deficiency in dimycocerosyl phthiocerol synthesis. J. Bacteriol. 2003
    
CitationThe methyl-branched fortifications of Mycobacterium tuberculosis. authors,DE. Minnikin,L. Kremer,LG. Dover,GS. Besra Chem. Biol. 2002njamshidiIPI12031661Actually a fatty acyl co-ligase, however condensation reaction is using free forms of fatty-acids or phthiocerol. see PMID: 12031661 and Cole et al Tuberculosis and the Tubercle Bacillus text, also PMID 15292272. PMID: 12730158 starts to elucidate which genes may be involved, but not yet definitively associated genes with the pathways leading up to pdima synthesis.
    
TermTBRXN:PPDIMAS PPDIM synthesis (Mycobacterium Tuberculosis) - IPInjamshidiIPI12031661Actually a fatty acyl co-ligase, however condensation reaction is using free forms of fatty-acids or phthiocerol. see PMID: 12031661 and Cole et al Tuberculosis and the Tubercle Bacillus text, also PMID 15292272. PMID: 12730158 starts to elucidate which genes may be involved, but not yet definitively associated genes with the pathways leading up to pdima synthesis.
    authors,DE. Minnikin,L. Kremer,LG. Dover,GS. Besra The methyl-branched fortifications of Mycobacterium tuberculosis. Chem. Biol. 2002
    
CitationCharacterization of three glycosyltransferases involved in the biosynthesis of the phenolic glycolipid antigens from the Mycobacterium tuberculosis complex. E. Prez, P. Constant et al. J. Biol. Chem. 2004njamshidiIPI12031661|15292272Actually a fatty acyl co-ligase, however condensation reaction is using free forms of fatty-acids or phthiocerol. see PMID: 12031661 and Cole et al Tuberculosis and the Tubercle Bacillus text, also PMID 15292272. PMID: 12730158 starts to elucidate which genes may be involved, but not yet definitively associated genes with the pathways leading up to pdima synthesis.
    
CitationThe methyl-branched fortifications of Mycobacterium tuberculosis. authors,DE. Minnikin,L. Kremer,LG. Dover,GS. Besra Chem. Biol. 2002njamshidiISS12031661Actually a fatty acyl co-ligase, however condensation reaction is using free forms of fatty-acids or phthiocerol. see PMID: 12031661 and Cole et al Tuberculosis and the Tubercle Bacillus text, also PMID 15292272. PMID: 12730158 starts to elucidate which genes may be involved, but not yet definitively associated genes with the pathways leading up to pdima synthesis.
    
CitationThe methyl-branched fortifications of Mycobacterium tuberculosis. authors,DE. Minnikin,L. Kremer,LG. Dover,GS. Besra Chem. Biol. 2002njamshidiISS12031661Actually a fatty acyl co-ligase, however condensation reaction is using free forms of fatty-acids or phthiocerol. see PMID: 12031661 and Cole et al Tuberculosis and the Tubercle Bacillus text. PMID: 12730158 starts to elucidate which genes may be involved, but not yet definitively associated genes with the pathways leading up to pdima synthesis.
    
TermTBRXN:PDIMAS PDIM A synthesis (Mycobacterium Tuberculosis) - ISSnjamshidiISS12031661Actually a fatty acyl co-ligase, however condensation reaction is using free forms of fatty-acids or phthiocerol. see PMID: 12031661 and Cole et al Tuberculosis and the Tubercle Bacillus text. PMID: 12730158 starts to elucidate which genes may be involved, but not yet definitively associated genes with the pathways leading up to pdima synthesis.
    authors,DE. Minnikin,L. Kremer,LG. Dover,GS. Besra The methyl-branched fortifications of Mycobacterium tuberculosis. Chem. Biol. 2002
    
CitationAttenuation of Mycobacterium tuberculosis by disruption of a mas-like gene or a chalcone synthase-like gene, which causes deficiency in dimycocerosyl phthiocerol synthesis. TD. Sirakova, VS. Dubey et al. J. Bacteriol. 2003njamshidiISS12031661|12730158Actually a fatty acyl co-ligase, however condensation reaction is using free forms of fatty-acids or phthiocerol. see PMID: 12031661 and Cole et al Tuberculosis and the Tubercle Bacillus text. PMID: 12730158 starts to elucidate which genes may be involved, but not yet definitively associated genes with the pathways leading up to pdima synthesis.
    
TermTBRXN:PDIMAS PDIM A synthesis (Mycobacterium Tuberculosis) - ISSnjamshidiISS12031661Actually a fatty acyl co-ligase, however condensation reaction is using free forms of fatty-acids or phthiocerol. see PMID: 12031661 and Cole et al Tuberculosis and the Tubercle Bacillus text. PMID: 12730158 starts to elucidate which genes may be involved, but not yet definitively associated genes with the pathways leading up to pdima synthesis.
    TD. Sirakova, VS. Dubey et al. Attenuation of Mycobacterium tuberculosis by disruption of a mas-like gene or a chalcone synthase-like gene, which causes deficiency in dimycocerosyl phthiocerol synthesis. J. Bacteriol. 2003
    
CitationThe methyl-branched fortifications of Mycobacterium tuberculosis. authors,DE. Minnikin,L. Kremer,LG. Dover,GS. Besra Chem. Biol. 2002njamshidiIPI12031661Actually a fatty acyl co-ligase, however condensation reaction is using free forms of fatty-acids or phthiocerol. see PMID: 12031661 and Cole et al Tuberculosis and the Tubercle Bacillus text. PMID: 12730158 starts to elucidate which genes may be involved, but not yet definitively associated genes with the pathways leading up to pdima synthesis.
    
TermTBRXN:PDIMAS PDIM A synthesis (Mycobacterium Tuberculosis) - IPInjamshidiIPI12031661Actually a fatty acyl co-ligase, however condensation reaction is using free forms of fatty-acids or phthiocerol. see PMID: 12031661 and Cole et al Tuberculosis and the Tubercle Bacillus text. PMID: 12730158 starts to elucidate which genes may be involved, but not yet definitively associated genes with the pathways leading up to pdima synthesis.
    authors,DE. Minnikin,L. Kremer,LG. Dover,GS. Besra The methyl-branched fortifications of Mycobacterium tuberculosis. Chem. Biol. 2002
    
CitationAttenuation of Mycobacterium tuberculosis by disruption of a mas-like gene or a chalcone synthase-like gene, which causes deficiency in dimycocerosyl phthiocerol synthesis. TD. Sirakova, VS. Dubey et al. J. Bacteriol. 2003njamshidiIPI12031661|12730158Actually a fatty acyl co-ligase, however condensation reaction is using free forms of fatty-acids or phthiocerol. see PMID: 12031661 and Cole et al Tuberculosis and the Tubercle Bacillus text. PMID: 12730158 starts to elucidate which genes may be involved, but not yet definitively associated genes with the pathways leading up to pdima synthesis.
    
TermTBRXN:PDIMAS PDIM A synthesis (Mycobacterium Tuberculosis) - IPInjamshidiIPI12031661Actually a fatty acyl co-ligase, however condensation reaction is using free forms of fatty-acids or phthiocerol. see PMID: 12031661 and Cole et al Tuberculosis and the Tubercle Bacillus text. PMID: 12730158 starts to elucidate which genes may be involved, but not yet definitively associated genes with the pathways leading up to pdima synthesis.
    TD. Sirakova, VS. Dubey et al. Attenuation of Mycobacterium tuberculosis by disruption of a mas-like gene or a chalcone synthase-like gene, which causes deficiency in dimycocerosyl phthiocerol synthesis. J. Bacteriol. 2003
    
InteractionPhysicalInteraction Rv2940cshahanup86IMPAffinity purification (Physical interaction)
    AM. Fitzmaurice & PE. Kolattukudy An acyl-CoA synthase (acoas) gene adjacent to the mycocerosic acid synthase (mas) locus is necessary for mycocerosyl lipid synthesis in Mycobacterium tuberculosis var. bovis BCG. J. Biol. Chem. 1998
    
InteractionRegulatedBy Rv1221yamir.morenoIEPMicroarrays. mRNA levels of regulated element measured and compared between wild-type  and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
    R. Manganelli, MI. Voskuil et al. The Mycobacterium tuberculosis ECF sigma factor sigmaE: role in global gene expression and survival in macrophages. Mol. Microbiol. 2001
    
NameLong chain fatty acyl-AMP ligase responsible for providing the long-chain fatty acid starter unit to Mas for the generation of mycocerosic acidsmjacksonIMPPhthiocerol dimycocerosates (PDIM), phenolic glycolipids (PGL) and para-hydroxybenzoic acid derivatives
    
NameLong chain fatty acyl-AMP ligase responsible for providing the long-chain fatty acid starter unit to Mas for the generation of mycocerosic acidsmjacksonIDAPhthiocerol dimycocerosates (PDIM), phenolic glycolipids (PGL) and para-hydroxybenzoic acid derivatives
    
CitationOpen reading frame 3, which is adjacent to the mycocerosic acid synthase gene, is expressed as an acyl coenzyme A synthase in Mycobacterium bovis BCG. authors,AM. Fitzmaurice,PE. Kolattukudy J. Bacteriol. 1997mjackson9098059Long chain fatty acyl-AMP ligase responsible for providing the long-chain fatty acid starter unit to Mas for the generation of mycocerosic acids (phenotypic [mycobacterial recombinant strains]; enzymatic)
    
OtherTBPWY:Phthiocerol dimycocerosates, PGL & pHBADmjacksonLong chain fatty acyl-AMP ligase responsible for providing the long-chain fatty acid starter unit to Mas for the generation of mycocerosic acids (phenotypic [mycobacterial recombinant strains]; enzymatic)
    authors,AM. Fitzmaurice,PE. Kolattukudy Open reading frame 3, which is adjacent to the mycocerosic acid synthase gene, is expressed as an acyl coenzyme A synthase in Mycobacterium bovis BCG. J. Bacteriol. 1997
    
CitationAn acyl-CoA synthase (acoas) gene adjacent to the mycocerosic acid synthase (mas) locus is necessary for mycocerosyl lipid synthesis in Mycobacterium tuberculosis var. bovis BCG. AM. Fitzmaurice & PE. Kolattukudy J. Biol. Chem. 1998mjackson9525903Long chain fatty acyl-AMP ligase responsible for providing the long-chain fatty acid starter unit to Mas for the generation of mycocerosic acids (phenotypic [mycobacterial recombinant strains]; enzymatic)
    
OtherTBPWY:Phthiocerol dimycocerosates, PGL & pHBADmjacksonLong chain fatty acyl-AMP ligase responsible for providing the long-chain fatty acid starter unit to Mas for the generation of mycocerosic acids (phenotypic [mycobacterial recombinant strains]; enzymatic)
    AM. Fitzmaurice & PE. Kolattukudy An acyl-CoA synthase (acoas) gene adjacent to the mycocerosic acid synthase (mas) locus is necessary for mycocerosyl lipid synthesis in Mycobacterium tuberculosis var. bovis BCG. J. Biol. Chem. 1998
    
CitationComplex lipid determines tissue-specific replication of Mycobacterium tuberculosis in mice. authors,JS. Cox,B. Chen,M. McNeil,WR. Jacobs Nature 1999mjackson10573420Long chain fatty acyl-AMP ligase responsible for providing the long-chain fatty acid starter unit to Mas for the generation of mycocerosic acids (phenotypic [mycobacterial recombinant strains]; enzymatic)
    
OtherTBPWY:Phthiocerol dimycocerosates, PGL & pHBADmjacksonLong chain fatty acyl-AMP ligase responsible for providing the long-chain fatty acid starter unit to Mas for the generation of mycocerosic acids (phenotypic [mycobacterial recombinant strains]; enzymatic)
    authors,JS. Cox,B. Chen,M. McNeil,WR. Jacobs Complex lipid determines tissue-specific replication of Mycobacterium tuberculosis in mice. Nature 1999
    
CitationAnalysis of the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. Evidence that this lipid is involved in the cell wall permeability barrier. LR. Camacho, P. Constant et al. J. Biol. Chem. 2001mjackson11279114Long chain fatty acyl-AMP ligase responsible for providing the long-chain fatty acid starter unit to Mas for the generation of mycocerosic acids (phenotypic [mycobacterial recombinant strains]; enzymatic)
    
OtherTBPWY:Phthiocerol dimycocerosates, PGL & pHBADmjacksonLong chain fatty acyl-AMP ligase responsible for providing the long-chain fatty acid starter unit to Mas for the generation of mycocerosic acids (phenotypic [mycobacterial recombinant strains]; enzymatic)
    LR. Camacho, P. Constant et al. Analysis of the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. Evidence that this lipid is involved in the cell wall permeability barrier. J. Biol. Chem. 2001
    
CitationEnzymic activation and transfer of fatty acids as acyl-adenylates in mycobacteria. OA. Trivedi,P. Arora,V. Sridharan,R. Tickoo,D. Mohanty,RS. Gokhale Nature 2004mjackson15042094Long chain fatty acyl-AMP ligase responsible for providing the long-chain fatty acid starter unit to Mas for the generation of mycocerosic acids (phenotypic [mycobacterial recombinant strains]; enzymatic)
    
OtherTBPWY:Phthiocerol dimycocerosates, PGL & pHBADmjacksonLong chain fatty acyl-AMP ligase responsible for providing the long-chain fatty acid starter unit to Mas for the generation of mycocerosic acids (phenotypic [mycobacterial recombinant strains]; enzymatic)
    OA. Trivedi,P. Arora,V. Sridharan,R. Tickoo,D. Mohanty,RS. Gokhale Enzymic activation and transfer of fatty acids as acyl-adenylates in mycobacteria. Nature 2004
    
CitationRole of the pks15/1 gene in the biosynthesis of phenolglycolipids in the Mycobacterium tuberculosis complex. Evidence that all strains synthesize glycosylated p-hydroxybenzoic methyl esters and that strains devoid of phenolglycolipids harbor a frameshift mutation in the pks15/1 gene. P. Constant, E. Perez et al. J. Biol. Chem. 2002jjmcfadden12138124Inferred from direct assay
    
TermEC:6.2.1.-  Ligases.  Forming carbon-sulfur bonds.   Acid--thiol ligases. - NRjjmcfaddenNRInferred from direct assay
    P. Constant, E. Perez et al. Role of the pks15/1 gene in the biosynthesis of phenolglycolipids in the Mycobacterium tuberculosis complex. Evidence that all strains synthesize glycosylated p-hydroxybenzoic methyl esters and that strains devoid of phenolglycolipids harbor a frameshift mutation in the pks15/1 gene. J. Biol. Chem. 2002
    
TermEC:6.2.1.3 Long-chain-fatty-acid--CoA ligase. - NRjjmcfaddenNRInferred from direct assay
    P. Constant, E. Perez et al. Role of the pks15/1 gene in the biosynthesis of phenolglycolipids in the Mycobacterium tuberculosis complex. Evidence that all strains synthesize glycosylated p-hydroxybenzoic methyl esters and that strains devoid of phenolglycolipids harbor a frameshift mutation in the pks15/1 gene. J. Biol. Chem. 2002
    

    


    Comments