TB Genome Annotation Portal

Rv2940c (mas)

Amino Acid Sequence

MESRVTPVAVIGMGCRLPGGINSPDKLWESLLRGDDLVTEIPPDRWDADDYYDPEPGVPGRSVSRWGGFLDDVAGFDAEFFGISEREATSIDPQQRLLLE
TSWEAIEHAGLDPASLAGSSTAVFTGLTHEDYLVLTTTAGGLASPYVVTGLNNSVASGRIAHTLGLHGPAMTFDTACSSGLMAVHLACRSLHDGEADLAL
AGGCAVLLEPHASVAASAQGMLSSTGRCHSFDADADGFVRSEGCAMVLLKRLPDALRDGNRIFAVVRGTATNQDGRTETLTMPSEDAQVAVYRAALAAAG
VQPETVGVVEAHGTGTPIGDPIEYRSLARVYGAGTPCALGSAKSNMGHSTASAGTVGLIKAILSLRHGVVPPLLHFNRLPDELSDVETGLFVPQAVTPWP
NGNDHTPKRVAVSSFGMSGTNVHAIVEEAPAEASAPESSPGDAEVGPRLFMLSSTSSDALRQTARQLATWVEEHQDCVAASDLAYTLARGRAHRPVRTAV
VAANLPELVEGLREVADGDALYDAAVGHGDRGPVWVFSGQGSQWAAMGTQLLASEPVFAATIAKLEPVIAAESGFSVTEAITAQQTVTGIDKVQPAVFAV
QVALAATMEQTYGVRPGAVVGHSMGESAAAVVAGALSLEDAARVICRRSKLMTRIAGAGAMGSVELPAKQVNSELMARGIDDVVVSVVASPQSTVIGGTS
DTVRDLIARWEQRDVMAREVAVDVASHSPQVDPILDDLAAALADIAPMTPKVPYYSATLFDPREQPVCDGAYWVDNLRNTVQFAAAVQAAMEDGYRVFAE
LSPHPLLTHAVEQTGRSLDMSVAALAGMRREQPLPHGLRGLLTELHRAGAALDYSALYPAGRLVDAPLPAWTHARLFIDDDGQEQRAQGACTITVHPLLG
SHVRLTEEPERHVWQGDVGTSVLSWLSDHQVHNVAALPGAAYCEMALAAAAEVFGEAAEVRDITFEQMLLLDEQTPIDAVASIDAPGVVNFTVETNRDGE
TTRHATAALRAAEDDCPPPGYDITALLQAHPHAVNGTAMRESFAERGVTLGAAFGGLTTAHTAEAGAATVLAEVALPASIRFQQGAYRIHPALLDACFQS
VGAGVQAGTATGGLLLPLGVRSLRAYGPTRNARYCYTRLTKAFNDGTRGGEADLDVLDEHGTVLLAVRGLRMGTGTSERDERDRLVSERLLTLGWQQRAL
PEVGDGEAGSWLLIDTSNAVDTPDMLASTLTDALKSHGPQGTECASLSWSVQDTPPNDQAGLEKLGSQLRGRDGVVIVYGPRVGDPDEHSLLAGREQVRH
LVRITRELAEFEGELPRLFVVTRQAQIVKPHDSGERANLEQAGLRGLLRVISSEHPMLRTTLIDVDEHTDVERVAQQLLSGSEEDETAWRNGDWYVARLT
PSPLGHEERRTAVLDPDHDGMRVQVRRPGDLQTLEFVASDRVPPGPGQIEVAVSMSSINFADVLIAFGRFPIIDDREPQLGMDFVGVVTAVGEGVTGHQV
GDRVGGFSEGGCWRTFLTCDANLAVTLPPGLTDEQAITAATAHATAWYGLNDLAQIKAGDKVLIHSATGGVGQAAISIARAKGAEIFATAGNPAKRAMLR
DMGVEHVYDSRSVEFAEQIRRDTDGYGVDIVLNSLTGAAQRAGLELLAFGGRFVEIGKADVYGNTRLGLFPFRRGLTFYYLDLALMSVTQPDRVRELLAT
VFKLTADGVLTAPQCTHYPLAEAADAIRAMSNAEHTGKLVLDVPRSGRRSVAVTPEQAPLYRRDGSYIITGGLGGLGLFFASKLAAAGCGRIVLTARSQP
NPKARQTIEGLRAAGADIVVECGNIAEPDTADRLVSAATATGLPLRGVLHSAAVVEDATLTNITDELIDRDWSPKVFGSWNLHRATLGQPLDWFCLFSSG
AALLGSPGQGAYAAANSWVDVFAHWRRAQGLPVSAIAWGAWGEVGRATFLAEGGEIMITPEEGAYAFETLVRHDRAYSGYIPILGAPWLADLVRRSPWGE
MFASTGQRSRGPSKFRMELLSLPQDEWAGRLRRLLVEQASVILRRTIDADRSFIEYGLDSLGMLEMRTHVETETGIRLTPKVIATNNTARALAQYLADTL
AEEQAAAPAAS
(Nucleotide sequence available on KEGG)

Additional Information




Analysis of Positive Selection in Clinical Isolates *new*

Moldova (2,057)global set (5,195)
under significant positive selection?YESNO
omega peak height (95%CI lower bound)4.97 (1.82)1.75 (0.92)
codons under selection493, 494, 495, 496, 497, 498
omega plots
genetic variantslinklink
statistics at each codonlinklink

ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across >100 conditions *new*

Classification Condition Strain Method Reference Notes
Non-Essential Sodium Oleate H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: 0.000000;
4 non-insertions in a row out of 81 sites
Non-Essential Lignoceric Acid H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: 0.000000;
2 non-insertions in a row out of 81 sites
Non-Essential Phosphatidylcholine H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: 0.000000;
3 non-insertions in a row out of 81 sites
Non-Essential minimal media + 0.1% glycerol H37RvMA Gumbel Griffin et al. (2011) Probability of Essentiality: 0.000000;
2 non-insertions in a row out of 82 sites
Non-Essential minimal media + 0.01% cholesterol H37RvMA Gumbel Griffin et al. (2011) Probability of Essentiality: 0.000000;
2 non-insertions in a row out of 82 sites
Non-Essential 7H10-glycerol H37RvMA TraSH Sassetti et al. (2003a)
Non-Essential C57BL/6J mice (8 weeks) H37RvMA TraSH Sassetti et al. (2003b) Hybridization Ratio: 0.73
Non-Essential 7H09/7H10 + rich media H37RvMA MotifHMM DeJesus et al. (2017) Fully saturated (14 reps).

TnSeq Data No data currently available.
  • No TnSeq data currently available for this Target.
RNASeq Data No data currently available.
  • No RNA-Seq data currently available for this Target.
Metabolomic Profiles No data currently available.
  • No Metabolomic data currently available for this Target.
Proteomic Data No data currently available.
  • No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology
  • BioCyc

    Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

    NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

    Interactions based on ChIPSeq data

  • Interactions based on ChIPSeq data (Minch et al. 2014)

    • Binds To:

      • No bindings to other targets were found.
    • Bound By:

    Interactions based on TFOE data (Rustad et al. 2014)

    • Upregulates:

      • Does not upregulate other genes.
    • Upregulated by:

      • Not upregulated by other genes.
    • Downregulates:

      • Does not downregulate other genes.
    • Downregulated by:



    TBCAP

    Tubculosis Community Annotation Project (
    Slayden et al., 2013)

    Rv2940c (mas)

    PropertyValueCreatorEvidencePMIDComment
    CitationFatty acid biosynthesis in Mycobacterium tuberculosis var. bovis Bacillus Calmette-Gurin. Purification and characterization of a novel fatty acid synthase, mycocerosic acid synthase, which elongates n-fatty acyl-CoA with methylmalonyl-CoA. authors,DL. Rainwater,PE. Kolattukudy J. Biol. Chem. 1985njamshidiISS3880746|1527058See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers
    TermTBRXN:FASm340 fatty acid synthase - octa-methyl tetracontatricosanoic acid - ISSnjamshidiISS1527058See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers
    authors,DL. Rainwater,PE. Kolattukudy Fatty acid biosynthesis in Mycobacterium tuberculosis var. bovis Bacillus Calmette-Gurin. Purification and characterization of a novel fatty acid synthase, mycocerosic acid synthase, which elongates n-fatty acyl-CoA with methylmalonyl-CoA. J. Biol. Chem. 1985
    CitationFatty acid biosynthesis in Mycobacterium tuberculosis var. bovis Bacillus Calmette-Gurin. Purification and characterization of a novel fatty acid synthase, mycocerosic acid synthase, which elongates n-fatty acyl-CoA with methylmalonyl-CoA. authors,DL. Rainwater,PE. Kolattukudy J. Biol. Chem. 1985njamshidiISS3880746|1527058See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers
    TermTBRXN:FASm340 fatty acid synthase - octa-methyl tetracontatricosanoic acid - ISSnjamshidiISS1527058See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers
    authors,DL. Rainwater,PE. Kolattukudy Fatty acid biosynthesis in Mycobacterium tuberculosis var. bovis Bacillus Calmette-Gurin. Purification and characterization of a novel fatty acid synthase, mycocerosic acid synthase, which elongates n-fatty acyl-CoA with methylmalonyl-CoA. J. Biol. Chem. 1985
    TermTBRXN:FASm320 fatty acid synthase - hepta-methyl dotriacontanoic acid - ISSnjamshidiISS1527058See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers
    authors,DL. Rainwater,PE. Kolattukudy Fatty acid biosynthesis in Mycobacterium tuberculosis var. bovis Bacillus Calmette-Gurin. Purification and characterization of a novel fatty acid synthase, mycocerosic acid synthase, which elongates n-fatty acyl-CoA with methylmalonyl-CoA. J. Biol. Chem. 1985
    CitationMolecular cloning and sequencing of the gene for mycocerosic acid synthase, a novel fatty acid elongating multifunctional enzyme, from Mycobacterium tuberculosis var. bovis Bacillus Calmette-Guerin. M. Mathur & PE. Kolattukudy J. Biol. Chem. 1992njamshidiIDA1527058See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers
    TermTBRXN:FASm340 fatty acid synthase - octa-methyl tetracontatricosanoic acid - IDAnjamshidiIDA1527058See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers
    M. Mathur & PE. Kolattukudy Molecular cloning and sequencing of the gene for mycocerosic acid synthase, a novel fatty acid elongating multifunctional enzyme, from Mycobacterium tuberculosis var. bovis Bacillus Calmette-Guerin. J. Biol. Chem. 1992
    CitationFatty acid biosynthesis in Mycobacterium tuberculosis var. bovis Bacillus Calmette-Gurin. Purification and characterization of a novel fatty acid synthase, mycocerosic acid synthase, which elongates n-fatty acyl-CoA with methylmalonyl-CoA. authors,DL. Rainwater,PE. Kolattukudy J. Biol. Chem. 1985njamshidiIDA3880746|1527058See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers
    TermTBRXN:FASm340 fatty acid synthase - octa-methyl tetracontatricosanoic acid - IDAnjamshidiIDA1527058See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers
    authors,DL. Rainwater,PE. Kolattukudy Fatty acid biosynthesis in Mycobacterium tuberculosis var. bovis Bacillus Calmette-Gurin. Purification and characterization of a novel fatty acid synthase, mycocerosic acid synthase, which elongates n-fatty acyl-CoA with methylmalonyl-CoA. J. Biol. Chem. 1985
    CitationFatty acid biosynthesis in Mycobacterium tuberculosis var. bovis Bacillus Calmette-Gurin. Purification and characterization of a novel fatty acid synthase, mycocerosic acid synthase, which elongates n-fatty acyl-CoA with methylmalonyl-CoA. authors,DL. Rainwater,PE. Kolattukudy J. Biol. Chem. 1985njamshidiIDA3880746|1527058See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers
    TermTBRXN:FASm340 fatty acid synthase - octa-methyl tetracontatricosanoic acid - IDAnjamshidiIDA1527058See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers
    authors,DL. Rainwater,PE. Kolattukudy Fatty acid biosynthesis in Mycobacterium tuberculosis var. bovis Bacillus Calmette-Gurin. Purification and characterization of a novel fatty acid synthase, mycocerosic acid synthase, which elongates n-fatty acyl-CoA with methylmalonyl-CoA. J. Biol. Chem. 1985
    CitationMolecular cloning and sequencing of the gene for mycocerosic acid synthase, a novel fatty acid elongating multifunctional enzyme, from Mycobacterium tuberculosis var. bovis Bacillus Calmette-Guerin. M. Mathur & PE. Kolattukudy J. Biol. Chem. 1992njamshidiISS1527058See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers
    TermTBRXN:FASm340 fatty acid synthase - octa-methyl tetracontatricosanoic acid - ISSnjamshidiISS1527058See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers
    M. Mathur & PE. Kolattukudy Molecular cloning and sequencing of the gene for mycocerosic acid synthase, a novel fatty acid elongating multifunctional enzyme, from Mycobacterium tuberculosis var. bovis Bacillus Calmette-Guerin. J. Biol. Chem. 1992
    CitationFatty acid biosynthesis in Mycobacterium tuberculosis var. bovis Bacillus Calmette-Gurin. Purification and characterization of a novel fatty acid synthase, mycocerosic acid synthase, which elongates n-fatty acyl-CoA with methylmalonyl-CoA. authors,DL. Rainwater,PE. Kolattukudy J. Biol. Chem. 1985njamshidiIDA3880746|1527058See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers
    TermTBRXN:FASm320 fatty acid synthase - hepta-methyl dotriacontanoic acid - IDAnjamshidiIDA1527058See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers
    authors,DL. Rainwater,PE. Kolattukudy Fatty acid biosynthesis in Mycobacterium tuberculosis var. bovis Bacillus Calmette-Gurin. Purification and characterization of a novel fatty acid synthase, mycocerosic acid synthase, which elongates n-fatty acyl-CoA with methylmalonyl-CoA. J. Biol. Chem. 1985
    CitationFatty acid biosynthesis in Mycobacterium tuberculosis var. bovis Bacillus Calmette-Gurin. Purification and characterization of a novel fatty acid synthase, mycocerosic acid synthase, which elongates n-fatty acyl-CoA with methylmalonyl-CoA. authors,DL. Rainwater,PE. Kolattukudy J. Biol. Chem. 1985njamshidiIDA3880746|1527058See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers
    TermTBRXN:FASm320 fatty acid synthase - hepta-methyl dotriacontanoic acid - IDAnjamshidiIDA1527058See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers
    authors,DL. Rainwater,PE. Kolattukudy Fatty acid biosynthesis in Mycobacterium tuberculosis var. bovis Bacillus Calmette-Gurin. Purification and characterization of a novel fatty acid synthase, mycocerosic acid synthase, which elongates n-fatty acyl-CoA with methylmalonyl-CoA. J. Biol. Chem. 1985
    CitationMolecular cloning and sequencing of the gene for mycocerosic acid synthase, a novel fatty acid elongating multifunctional enzyme, from Mycobacterium tuberculosis var. bovis Bacillus Calmette-Guerin. M. Mathur & PE. Kolattukudy J. Biol. Chem. 1992njamshidiISS1527058See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers
    TermTBRXN:FASm320 fatty acid synthase - hepta-methyl dotriacontanoic acid - ISSnjamshidiISS1527058See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers
    M. Mathur & PE. Kolattukudy Molecular cloning and sequencing of the gene for mycocerosic acid synthase, a novel fatty acid elongating multifunctional enzyme, from Mycobacterium tuberculosis var. bovis Bacillus Calmette-Guerin. J. Biol. Chem. 1992
    CitationFatty acid biosynthesis in Mycobacterium tuberculosis var. bovis Bacillus Calmette-Gurin. Purification and characterization of a novel fatty acid synthase, mycocerosic acid synthase, which elongates n-fatty acyl-CoA with methylmalonyl-CoA. authors,DL. Rainwater,PE. Kolattukudy J. Biol. Chem. 1985njamshidiISS3880746|1527058See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers
    TermTBRXN:FASm320 fatty acid synthase - hepta-methyl dotriacontanoic acid - ISSnjamshidiISS1527058See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers
    authors,DL. Rainwater,PE. Kolattukudy Fatty acid biosynthesis in Mycobacterium tuberculosis var. bovis Bacillus Calmette-Gurin. Purification and characterization of a novel fatty acid synthase, mycocerosic acid synthase, which elongates n-fatty acyl-CoA with methylmalonyl-CoA. J. Biol. Chem. 1985
    CitationFatty acid biosynthesis in Mycobacterium tuberculosis var. bovis Bacillus Calmette-Gurin. Purification and characterization of a novel fatty acid synthase, mycocerosic acid synthase, which elongates n-fatty acyl-CoA with methylmalonyl-CoA. authors,DL. Rainwater,PE. Kolattukudy J. Biol. Chem. 1985njamshidiISS3880746|1527058See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers
    TermTBRXN:FASm300 fatty acid synthase - hexa-methyl triacontanoic acid - IDAnjamshidiIDA1527058See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers
    authors,DL. Rainwater,PE. Kolattukudy Fatty acid biosynthesis in Mycobacterium tuberculosis var. bovis Bacillus Calmette-Gurin. Purification and characterization of a novel fatty acid synthase, mycocerosic acid synthase, which elongates n-fatty acyl-CoA with methylmalonyl-CoA. J. Biol. Chem. 1985
    CitationMolecular cloning and sequencing of the gene for mycocerosic acid synthase, a novel fatty acid elongating multifunctional enzyme, from Mycobacterium tuberculosis var. bovis Bacillus Calmette-Guerin. M. Mathur & PE. Kolattukudy J. Biol. Chem. 1992njamshidiISS1527058See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers
    TermTBRXN:FASm300 fatty acid synthase - hexa-methyl triacontanoic acid - ISSnjamshidiISS1527058See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers
    M. Mathur & PE. Kolattukudy Molecular cloning and sequencing of the gene for mycocerosic acid synthase, a novel fatty acid elongating multifunctional enzyme, from Mycobacterium tuberculosis var. bovis Bacillus Calmette-Guerin. J. Biol. Chem. 1992
    CitationFatty acid biosynthesis in Mycobacterium tuberculosis var. bovis Bacillus Calmette-Gurin. Purification and characterization of a novel fatty acid synthase, mycocerosic acid synthase, which elongates n-fatty acyl-CoA with methylmalonyl-CoA. authors,DL. Rainwater,PE. Kolattukudy J. Biol. Chem. 1985njamshidiISS3880746|1527058See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers
    TermTBRXN:FASm300 fatty acid synthase - hexa-methyl triacontanoic acid - ISSnjamshidiISS1527058See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers
    authors,DL. Rainwater,PE. Kolattukudy Fatty acid biosynthesis in Mycobacterium tuberculosis var. bovis Bacillus Calmette-Gurin. Purification and characterization of a novel fatty acid synthase, mycocerosic acid synthase, which elongates n-fatty acyl-CoA with methylmalonyl-CoA. J. Biol. Chem. 1985
    CitationFatty acid biosynthesis in Mycobacterium tuberculosis var. bovis Bacillus Calmette-Gurin. Purification and characterization of a novel fatty acid synthase, mycocerosic acid synthase, which elongates n-fatty acyl-CoA with methylmalonyl-CoA. authors,DL. Rainwater,PE. Kolattukudy J. Biol. Chem. 1985njamshidiISS3880746|1527058See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers
    TermTBRXN:FASm300 fatty acid synthase - hexa-methyl triacontanoic acid - ISSnjamshidiISS1527058See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers
    authors,DL. Rainwater,PE. Kolattukudy Fatty acid biosynthesis in Mycobacterium tuberculosis var. bovis Bacillus Calmette-Gurin. Purification and characterization of a novel fatty acid synthase, mycocerosic acid synthase, which elongates n-fatty acyl-CoA with methylmalonyl-CoA. J. Biol. Chem. 1985
    CitationMolecular cloning and sequencing of the gene for mycocerosic acid synthase, a novel fatty acid elongating multifunctional enzyme, from Mycobacterium tuberculosis var. bovis Bacillus Calmette-Guerin. M. Mathur & PE. Kolattukudy J. Biol. Chem. 1992njamshidiIDA1527058See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers
    TermTBRXN:FASm320 fatty acid synthase - hepta-methyl dotriacontanoic acid - IDAnjamshidiIDA1527058See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers
    M. Mathur & PE. Kolattukudy Molecular cloning and sequencing of the gene for mycocerosic acid synthase, a novel fatty acid elongating multifunctional enzyme, from Mycobacterium tuberculosis var. bovis Bacillus Calmette-Guerin. J. Biol. Chem. 1992
    CitationFatty acid biosynthesis in Mycobacterium tuberculosis var. bovis Bacillus Calmette-Gurin. Purification and characterization of a novel fatty acid synthase, mycocerosic acid synthase, which elongates n-fatty acyl-CoA with methylmalonyl-CoA. authors,DL. Rainwater,PE. Kolattukudy J. Biol. Chem. 1985njamshidiISS3880746|1527058See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers
    TermTBRXN:FASm2802 fatty acid synthase - penta-methyl octacosanoic acid - ISSnjamshidiISS1527058See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers
    authors,DL. Rainwater,PE. Kolattukudy Fatty acid biosynthesis in Mycobacterium tuberculosis var. bovis Bacillus Calmette-Gurin. Purification and characterization of a novel fatty acid synthase, mycocerosic acid synthase, which elongates n-fatty acyl-CoA with methylmalonyl-CoA. J. Biol. Chem. 1985
    CitationFatty acid biosynthesis in Mycobacterium tuberculosis var. bovis Bacillus Calmette-Gurin. Purification and characterization of a novel fatty acid synthase, mycocerosic acid synthase, which elongates n-fatty acyl-CoA with methylmalonyl-CoA. authors,DL. Rainwater,PE. Kolattukudy J. Biol. Chem. 1985njamshidiISS3880746|1527058See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers
    TermTBRXN:FASm2802 fatty acid synthase - penta-methyl octacosanoic acid - ISSnjamshidiISS1527058See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers
    authors,DL. Rainwater,PE. Kolattukudy Fatty acid biosynthesis in Mycobacterium tuberculosis var. bovis Bacillus Calmette-Gurin. Purification and characterization of a novel fatty acid synthase, mycocerosic acid synthase, which elongates n-fatty acyl-CoA with methylmalonyl-CoA. J. Biol. Chem. 1985
    CitationMolecular cloning and sequencing of the gene for mycocerosic acid synthase, a novel fatty acid elongating multifunctional enzyme, from Mycobacterium tuberculosis var. bovis Bacillus Calmette-Guerin. M. Mathur & PE. Kolattukudy J. Biol. Chem. 1992njamshidiIDA1527058See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers
    TermTBRXN:FASm300 fatty acid synthase - hexa-methyl triacontanoic acid - IDAnjamshidiIDA1527058See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers
    M. Mathur & PE. Kolattukudy Molecular cloning and sequencing of the gene for mycocerosic acid synthase, a novel fatty acid elongating multifunctional enzyme, from Mycobacterium tuberculosis var. bovis Bacillus Calmette-Guerin. J. Biol. Chem. 1992
    CitationFatty acid biosynthesis in Mycobacterium tuberculosis var. bovis Bacillus Calmette-Gurin. Purification and characterization of a novel fatty acid synthase, mycocerosic acid synthase, which elongates n-fatty acyl-CoA with methylmalonyl-CoA. authors,DL. Rainwater,PE. Kolattukudy J. Biol. Chem. 1985njamshidiIDA3880746|1527058See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers
    TermTBRXN:FASm300 fatty acid synthase - hexa-methyl triacontanoic acid - IDAnjamshidiIDA1527058See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers
    authors,DL. Rainwater,PE. Kolattukudy Fatty acid biosynthesis in Mycobacterium tuberculosis var. bovis Bacillus Calmette-Gurin. Purification and characterization of a novel fatty acid synthase, mycocerosic acid synthase, which elongates n-fatty acyl-CoA with methylmalonyl-CoA. J. Biol. Chem. 1985
    CitationFatty acid biosynthesis in Mycobacterium tuberculosis var. bovis Bacillus Calmette-Gurin. Purification and characterization of a novel fatty acid synthase, mycocerosic acid synthase, which elongates n-fatty acyl-CoA with methylmalonyl-CoA. authors,DL. Rainwater,PE. Kolattukudy J. Biol. Chem. 1985njamshidiIDA3880746|1527058See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers
    TermTBRXN:FASm280 fatty acid synthase - tetra-methyl octacosanoic acid - ISSnjamshidiISS1527058See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers
    authors,DL. Rainwater,PE. Kolattukudy Fatty acid biosynthesis in Mycobacterium tuberculosis var. bovis Bacillus Calmette-Gurin. Purification and characterization of a novel fatty acid synthase, mycocerosic acid synthase, which elongates n-fatty acyl-CoA with methylmalonyl-CoA. J. Biol. Chem. 1985
    CitationMolecular cloning and sequencing of the gene for mycocerosic acid synthase, a novel fatty acid elongating multifunctional enzyme, from Mycobacterium tuberculosis var. bovis Bacillus Calmette-Guerin. M. Mathur & PE. Kolattukudy J. Biol. Chem. 1992njamshidiIDA1527058See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers
    TermTBRXN:FASm2802 fatty acid synthase - penta-methyl octacosanoic acid - IDAnjamshidiIDA1527058See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers
    M. Mathur & PE. Kolattukudy Molecular cloning and sequencing of the gene for mycocerosic acid synthase, a novel fatty acid elongating multifunctional enzyme, from Mycobacterium tuberculosis var. bovis Bacillus Calmette-Guerin. J. Biol. Chem. 1992
    CitationFatty acid biosynthesis in Mycobacterium tuberculosis var. bovis Bacillus Calmette-Gurin. Purification and characterization of a novel fatty acid synthase, mycocerosic acid synthase, which elongates n-fatty acyl-CoA with methylmalonyl-CoA. authors,DL. Rainwater,PE. Kolattukudy J. Biol. Chem. 1985njamshidiIDA3880746|1527058See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers
    TermTBRXN:FASm2802 fatty acid synthase - penta-methyl octacosanoic acid - IDAnjamshidiIDA1527058See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers
    authors,DL. Rainwater,PE. Kolattukudy Fatty acid biosynthesis in Mycobacterium tuberculosis var. bovis Bacillus Calmette-Gurin. Purification and characterization of a novel fatty acid synthase, mycocerosic acid synthase, which elongates n-fatty acyl-CoA with methylmalonyl-CoA. J. Biol. Chem. 1985
    CitationFatty acid biosynthesis in Mycobacterium tuberculosis var. bovis Bacillus Calmette-Gurin. Purification and characterization of a novel fatty acid synthase, mycocerosic acid synthase, which elongates n-fatty acyl-CoA with methylmalonyl-CoA. authors,DL. Rainwater,PE. Kolattukudy J. Biol. Chem. 1985njamshidiIDA3880746|1527058See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers
    TermTBRXN:FASm2802 fatty acid synthase - penta-methyl octacosanoic acid - IDAnjamshidiIDA1527058See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers
    authors,DL. Rainwater,PE. Kolattukudy Fatty acid biosynthesis in Mycobacterium tuberculosis var. bovis Bacillus Calmette-Gurin. Purification and characterization of a novel fatty acid synthase, mycocerosic acid synthase, which elongates n-fatty acyl-CoA with methylmalonyl-CoA. J. Biol. Chem. 1985
    CitationMolecular cloning and sequencing of the gene for mycocerosic acid synthase, a novel fatty acid elongating multifunctional enzyme, from Mycobacterium tuberculosis var. bovis Bacillus Calmette-Guerin. M. Mathur & PE. Kolattukudy J. Biol. Chem. 1992njamshidiISS1527058See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers
    TermTBRXN:FASm2802 fatty acid synthase - penta-methyl octacosanoic acid - ISSnjamshidiISS1527058See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers
    M. Mathur & PE. Kolattukudy Molecular cloning and sequencing of the gene for mycocerosic acid synthase, a novel fatty acid elongating multifunctional enzyme, from Mycobacterium tuberculosis var. bovis Bacillus Calmette-Guerin. J. Biol. Chem. 1992
    CitationFatty acid biosynthesis in Mycobacterium tuberculosis var. bovis Bacillus Calmette-Gurin. Purification and characterization of a novel fatty acid synthase, mycocerosic acid synthase, which elongates n-fatty acyl-CoA with methylmalonyl-CoA. authors,DL. Rainwater,PE. Kolattukudy J. Biol. Chem. 1985njamshidiIDA3880746|1527058See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers
    TermTBRXN:FASm280 fatty acid synthase - tetra-methyl octacosanoic acid - IDAnjamshidiIDA1527058See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers
    authors,DL. Rainwater,PE. Kolattukudy Fatty acid biosynthesis in Mycobacterium tuberculosis var. bovis Bacillus Calmette-Gurin. Purification and characterization of a novel fatty acid synthase, mycocerosic acid synthase, which elongates n-fatty acyl-CoA with methylmalonyl-CoA. J. Biol. Chem. 1985
    CitationFatty acid biosynthesis in Mycobacterium tuberculosis var. bovis Bacillus Calmette-Gurin. Purification and characterization of a novel fatty acid synthase, mycocerosic acid synthase, which elongates n-fatty acyl-CoA with methylmalonyl-CoA. authors,DL. Rainwater,PE. Kolattukudy J. Biol. Chem. 1985njamshidiIDA3880746|1527058See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers
    TermTBRXN:FASm280 fatty acid synthase - tetra-methyl octacosanoic acid - IDAnjamshidiIDA1527058See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers
    authors,DL. Rainwater,PE. Kolattukudy Fatty acid biosynthesis in Mycobacterium tuberculosis var. bovis Bacillus Calmette-Gurin. Purification and characterization of a novel fatty acid synthase, mycocerosic acid synthase, which elongates n-fatty acyl-CoA with methylmalonyl-CoA. J. Biol. Chem. 1985
    CitationMolecular cloning and sequencing of the gene for mycocerosic acid synthase, a novel fatty acid elongating multifunctional enzyme, from Mycobacterium tuberculosis var. bovis Bacillus Calmette-Guerin. M. Mathur & PE. Kolattukudy J. Biol. Chem. 1992njamshidiISS1527058See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers
    TermTBRXN:FASm280 fatty acid synthase - tetra-methyl octacosanoic acid - ISSnjamshidiISS1527058See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers
    M. Mathur & PE. Kolattukudy Molecular cloning and sequencing of the gene for mycocerosic acid synthase, a novel fatty acid elongating multifunctional enzyme, from Mycobacterium tuberculosis var. bovis Bacillus Calmette-Guerin. J. Biol. Chem. 1992
    CitationFatty acid biosynthesis in Mycobacterium tuberculosis var. bovis Bacillus Calmette-Gurin. Purification and characterization of a novel fatty acid synthase, mycocerosic acid synthase, which elongates n-fatty acyl-CoA with methylmalonyl-CoA. authors,DL. Rainwater,PE. Kolattukudy J. Biol. Chem. 1985njamshidiISS3880746|1527058See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers
    TermTBRXN:FASm280 fatty acid synthase - tetra-methyl octacosanoic acid - ISSnjamshidiISS1527058See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers
    authors,DL. Rainwater,PE. Kolattukudy Fatty acid biosynthesis in Mycobacterium tuberculosis var. bovis Bacillus Calmette-Gurin. Purification and characterization of a novel fatty acid synthase, mycocerosic acid synthase, which elongates n-fatty acyl-CoA with methylmalonyl-CoA. J. Biol. Chem. 1985
    CitationFatty acid biosynthesis in Mycobacterium tuberculosis var. bovis Bacillus Calmette-Gurin. Purification and characterization of a novel fatty acid synthase, mycocerosic acid synthase, which elongates n-fatty acyl-CoA with methylmalonyl-CoA. authors,DL. Rainwater,PE. Kolattukudy J. Biol. Chem. 1985njamshidiISS3880746|1527058See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers
    TermTBRXN:FASm2602 fatty acid synthase - tetra-methyl hexacosanoic acid - IDAnjamshidiIDA1527058See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers
    authors,DL. Rainwater,PE. Kolattukudy Fatty acid biosynthesis in Mycobacterium tuberculosis var. bovis Bacillus Calmette-Gurin. Purification and characterization of a novel fatty acid synthase, mycocerosic acid synthase, which elongates n-fatty acyl-CoA with methylmalonyl-CoA. J. Biol. Chem. 1985
    CitationMolecular cloning and sequencing of the gene for mycocerosic acid synthase, a novel fatty acid elongating multifunctional enzyme, from Mycobacterium tuberculosis var. bovis Bacillus Calmette-Guerin. M. Mathur & PE. Kolattukudy J. Biol. Chem. 1992njamshidiISS1527058See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers
    TermTBRXN:FASm2602 fatty acid synthase - tetra-methyl hexacosanoic acid - ISSnjamshidiISS1527058See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers
    M. Mathur & PE. Kolattukudy Molecular cloning and sequencing of the gene for mycocerosic acid synthase, a novel fatty acid elongating multifunctional enzyme, from Mycobacterium tuberculosis var. bovis Bacillus Calmette-Guerin. J. Biol. Chem. 1992
    CitationFatty acid biosynthesis in Mycobacterium tuberculosis var. bovis Bacillus Calmette-Gurin. Purification and characterization of a novel fatty acid synthase, mycocerosic acid synthase, which elongates n-fatty acyl-CoA with methylmalonyl-CoA. authors,DL. Rainwater,PE. Kolattukudy J. Biol. Chem. 1985njamshidiISS3880746|1527058See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers
    TermTBRXN:FASm2602 fatty acid synthase - tetra-methyl hexacosanoic acid - ISSnjamshidiISS1527058See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers
    authors,DL. Rainwater,PE. Kolattukudy Fatty acid biosynthesis in Mycobacterium tuberculosis var. bovis Bacillus Calmette-Gurin. Purification and characterization of a novel fatty acid synthase, mycocerosic acid synthase, which elongates n-fatty acyl-CoA with methylmalonyl-CoA. J. Biol. Chem. 1985
    CitationFatty acid biosynthesis in Mycobacterium tuberculosis var. bovis Bacillus Calmette-Gurin. Purification and characterization of a novel fatty acid synthase, mycocerosic acid synthase, which elongates n-fatty acyl-CoA with methylmalonyl-CoA. authors,DL. Rainwater,PE. Kolattukudy J. Biol. Chem. 1985njamshidiISS3880746|1527058See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers
    TermTBRXN:FASm2602 fatty acid synthase - tetra-methyl hexacosanoic acid - ISSnjamshidiISS1527058See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers
    authors,DL. Rainwater,PE. Kolattukudy Fatty acid biosynthesis in Mycobacterium tuberculosis var. bovis Bacillus Calmette-Gurin. Purification and characterization of a novel fatty acid synthase, mycocerosic acid synthase, which elongates n-fatty acyl-CoA with methylmalonyl-CoA. J. Biol. Chem. 1985
    CitationMolecular cloning and sequencing of the gene for mycocerosic acid synthase, a novel fatty acid elongating multifunctional enzyme, from Mycobacterium tuberculosis var. bovis Bacillus Calmette-Guerin. M. Mathur & PE. Kolattukudy J. Biol. Chem. 1992njamshidiIDA1527058See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers
    TermTBRXN:FASm280 fatty acid synthase - tetra-methyl octacosanoic acid - IDAnjamshidiIDA1527058See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers
    M. Mathur & PE. Kolattukudy Molecular cloning and sequencing of the gene for mycocerosic acid synthase, a novel fatty acid elongating multifunctional enzyme, from Mycobacterium tuberculosis var. bovis Bacillus Calmette-Guerin. J. Biol. Chem. 1992
    CitationFatty acid biosynthesis in Mycobacterium tuberculosis var. bovis Bacillus Calmette-Gurin. Purification and characterization of a novel fatty acid synthase, mycocerosic acid synthase, which elongates n-fatty acyl-CoA with methylmalonyl-CoA. authors,DL. Rainwater,PE. Kolattukudy J. Biol. Chem. 1985njamshidiISS3880746|1527058See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers
    TermTBRXN:FASm260 fatty acid synthase - tri-methyl cerotic acid - ISSnjamshidiISS1527058See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers
    authors,DL. Rainwater,PE. Kolattukudy Fatty acid biosynthesis in Mycobacterium tuberculosis var. bovis Bacillus Calmette-Gurin. Purification and characterization of a novel fatty acid synthase, mycocerosic acid synthase, which elongates n-fatty acyl-CoA with methylmalonyl-CoA. J. Biol. Chem. 1985
    CitationFatty acid biosynthesis in Mycobacterium tuberculosis var. bovis Bacillus Calmette-Gurin. Purification and characterization of a novel fatty acid synthase, mycocerosic acid synthase, which elongates n-fatty acyl-CoA with methylmalonyl-CoA. authors,DL. Rainwater,PE. Kolattukudy J. Biol. Chem. 1985njamshidiISS3880746|1527058See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers
    TermTBRXN:FASm260 fatty acid synthase - tri-methyl cerotic acid - ISSnjamshidiISS1527058See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers
    authors,DL. Rainwater,PE. Kolattukudy Fatty acid biosynthesis in Mycobacterium tuberculosis var. bovis Bacillus Calmette-Gurin. Purification and characterization of a novel fatty acid synthase, mycocerosic acid synthase, which elongates n-fatty acyl-CoA with methylmalonyl-CoA. J. Biol. Chem. 1985
    CitationMolecular cloning and sequencing of the gene for mycocerosic acid synthase, a novel fatty acid elongating multifunctional enzyme, from Mycobacterium tuberculosis var. bovis Bacillus Calmette-Guerin. M. Mathur & PE. Kolattukudy J. Biol. Chem. 1992njamshidiIDA1527058See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers
    TermTBRXN:FASm2602 fatty acid synthase - tetra-methyl hexacosanoic acid - IDAnjamshidiIDA1527058See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers
    M. Mathur & PE. Kolattukudy Molecular cloning and sequencing of the gene for mycocerosic acid synthase, a novel fatty acid elongating multifunctional enzyme, from Mycobacterium tuberculosis var. bovis Bacillus Calmette-Guerin. J. Biol. Chem. 1992
    CitationFatty acid biosynthesis in Mycobacterium tuberculosis var. bovis Bacillus Calmette-Gurin. Purification and characterization of a novel fatty acid synthase, mycocerosic acid synthase, which elongates n-fatty acyl-CoA with methylmalonyl-CoA. authors,DL. Rainwater,PE. Kolattukudy J. Biol. Chem. 1985njamshidiIDA3880746|1527058See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers
    TermTBRXN:FASm2602 fatty acid synthase - tetra-methyl hexacosanoic acid - IDAnjamshidiIDA1527058See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers
    authors,DL. Rainwater,PE. Kolattukudy Fatty acid biosynthesis in Mycobacterium tuberculosis var. bovis Bacillus Calmette-Gurin. Purification and characterization of a novel fatty acid synthase, mycocerosic acid synthase, which elongates n-fatty acyl-CoA with methylmalonyl-CoA. J. Biol. Chem. 1985
    CitationFatty acid biosynthesis in Mycobacterium tuberculosis var. bovis Bacillus Calmette-Gurin. Purification and characterization of a novel fatty acid synthase, mycocerosic acid synthase, which elongates n-fatty acyl-CoA with methylmalonyl-CoA. authors,DL. Rainwater,PE. Kolattukudy J. Biol. Chem. 1985njamshidiIDA3880746|1527058See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers
    TermTBRXN:FASm2402 fatty acid synthase - tri-methyl-lignoceric acid - ISSnjamshidiISS1527058See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers
    authors,DL. Rainwater,PE. Kolattukudy Fatty acid biosynthesis in Mycobacterium tuberculosis var. bovis Bacillus Calmette-Gurin. Purification and characterization of a novel fatty acid synthase, mycocerosic acid synthase, which elongates n-fatty acyl-CoA with methylmalonyl-CoA. J. Biol. Chem. 1985
    CitationMolecular cloning and sequencing of the gene for mycocerosic acid synthase, a novel fatty acid elongating multifunctional enzyme, from Mycobacterium tuberculosis var. bovis Bacillus Calmette-Guerin. M. Mathur & PE. Kolattukudy J. Biol. Chem. 1992njamshidiIDA1527058See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers
    TermTBRXN:FASm260 fatty acid synthase - tri-methyl cerotic acid - IDAnjamshidiIDA1527058See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers
    M. Mathur & PE. Kolattukudy Molecular cloning and sequencing of the gene for mycocerosic acid synthase, a novel fatty acid elongating multifunctional enzyme, from Mycobacterium tuberculosis var. bovis Bacillus Calmette-Guerin. J. Biol. Chem. 1992
    CitationFatty acid biosynthesis in Mycobacterium tuberculosis var. bovis Bacillus Calmette-Gurin. Purification and characterization of a novel fatty acid synthase, mycocerosic acid synthase, which elongates n-fatty acyl-CoA with methylmalonyl-CoA. authors,DL. Rainwater,PE. Kolattukudy J. Biol. Chem. 1985njamshidiIDA3880746|1527058See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers
    TermTBRXN:FASm260 fatty acid synthase - tri-methyl cerotic acid - IDAnjamshidiIDA1527058See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers
    authors,DL. Rainwater,PE. Kolattukudy Fatty acid biosynthesis in Mycobacterium tuberculosis var. bovis Bacillus Calmette-Gurin. Purification and characterization of a novel fatty acid synthase, mycocerosic acid synthase, which elongates n-fatty acyl-CoA with methylmalonyl-CoA. J. Biol. Chem. 1985
    CitationFatty acid biosynthesis in Mycobacterium tuberculosis var. bovis Bacillus Calmette-Gurin. Purification and characterization of a novel fatty acid synthase, mycocerosic acid synthase, which elongates n-fatty acyl-CoA with methylmalonyl-CoA. authors,DL. Rainwater,PE. Kolattukudy J. Biol. Chem. 1985njamshidiIDA3880746|1527058See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers
    TermTBRXN:FASm260 fatty acid synthase - tri-methyl cerotic acid - IDAnjamshidiIDA1527058See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers
    authors,DL. Rainwater,PE. Kolattukudy Fatty acid biosynthesis in Mycobacterium tuberculosis var. bovis Bacillus Calmette-Gurin. Purification and characterization of a novel fatty acid synthase, mycocerosic acid synthase, which elongates n-fatty acyl-CoA with methylmalonyl-CoA. J. Biol. Chem. 1985
    CitationMolecular cloning and sequencing of the gene for mycocerosic acid synthase, a novel fatty acid elongating multifunctional enzyme, from Mycobacterium tuberculosis var. bovis Bacillus Calmette-Guerin. M. Mathur & PE. Kolattukudy J. Biol. Chem. 1992njamshidiISS1527058See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers
    TermTBRXN:FASm260 fatty acid synthase - tri-methyl cerotic acid - ISSnjamshidiISS1527058See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers
    M. Mathur & PE. Kolattukudy Molecular cloning and sequencing of the gene for mycocerosic acid synthase, a novel fatty acid elongating multifunctional enzyme, from Mycobacterium tuberculosis var. bovis Bacillus Calmette-Guerin. J. Biol. Chem. 1992
    CitationFatty acid biosynthesis in Mycobacterium tuberculosis var. bovis Bacillus Calmette-Gurin. Purification and characterization of a novel fatty acid synthase, mycocerosic acid synthase, which elongates n-fatty acyl-CoA with methylmalonyl-CoA. authors,DL. Rainwater,PE. Kolattukudy J. Biol. Chem. 1985njamshidiIDA3880746|1527058See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers
    TermTBRXN:FASm2402 fatty acid synthase - tri-methyl-lignoceric acid - IDAnjamshidiIDA1527058See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers
    authors,DL. Rainwater,PE. Kolattukudy Fatty acid biosynthesis in Mycobacterium tuberculosis var. bovis Bacillus Calmette-Gurin. Purification and characterization of a novel fatty acid synthase, mycocerosic acid synthase, which elongates n-fatty acyl-CoA with methylmalonyl-CoA. J. Biol. Chem. 1985
    CitationFatty acid biosynthesis in Mycobacterium tuberculosis var. bovis Bacillus Calmette-Gurin. Purification and characterization of a novel fatty acid synthase, mycocerosic acid synthase, which elongates n-fatty acyl-CoA with methylmalonyl-CoA. authors,DL. Rainwater,PE. Kolattukudy J. Biol. Chem. 1985njamshidiIDA3880746|1527058See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers
    TermTBRXN:FASm2402 fatty acid synthase - tri-methyl-lignoceric acid - IDAnjamshidiIDA1527058See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers
    authors,DL. Rainwater,PE. Kolattukudy Fatty acid biosynthesis in Mycobacterium tuberculosis var. bovis Bacillus Calmette-Gurin. Purification and characterization of a novel fatty acid synthase, mycocerosic acid synthase, which elongates n-fatty acyl-CoA with methylmalonyl-CoA. J. Biol. Chem. 1985
    CitationMolecular cloning and sequencing of the gene for mycocerosic acid synthase, a novel fatty acid elongating multifunctional enzyme, from Mycobacterium tuberculosis var. bovis Bacillus Calmette-Guerin. M. Mathur & PE. Kolattukudy J. Biol. Chem. 1992njamshidiISS1527058See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers
    TermTBRXN:FASm2402 fatty acid synthase - tri-methyl-lignoceric acid - ISSnjamshidiISS1527058See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers
    M. Mathur & PE. Kolattukudy Molecular cloning and sequencing of the gene for mycocerosic acid synthase, a novel fatty acid elongating multifunctional enzyme, from Mycobacterium tuberculosis var. bovis Bacillus Calmette-Guerin. J. Biol. Chem. 1992
    CitationFatty acid biosynthesis in Mycobacterium tuberculosis var. bovis Bacillus Calmette-Gurin. Purification and characterization of a novel fatty acid synthase, mycocerosic acid synthase, which elongates n-fatty acyl-CoA with methylmalonyl-CoA. authors,DL. Rainwater,PE. Kolattukudy J. Biol. Chem. 1985njamshidiISS3880746|1527058See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers
    TermTBRXN:FASm2402 fatty acid synthase - tri-methyl-lignoceric acid - ISSnjamshidiISS1527058See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers
    authors,DL. Rainwater,PE. Kolattukudy Fatty acid biosynthesis in Mycobacterium tuberculosis var. bovis Bacillus Calmette-Gurin. Purification and characterization of a novel fatty acid synthase, mycocerosic acid synthase, which elongates n-fatty acyl-CoA with methylmalonyl-CoA. J. Biol. Chem. 1985
    CitationFatty acid biosynthesis in Mycobacterium tuberculosis var. bovis Bacillus Calmette-Gurin. Purification and characterization of a novel fatty acid synthase, mycocerosic acid synthase, which elongates n-fatty acyl-CoA with methylmalonyl-CoA. authors,DL. Rainwater,PE. Kolattukudy J. Biol. Chem. 1985njamshidiISS3880746|1527058See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers
    TermTBRXN:FASm240 fatty acid synthase - di-methyl lignoceric acid - IDAnjamshidiIDA1527058See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers
    authors,DL. Rainwater,PE. Kolattukudy Fatty acid biosynthesis in Mycobacterium tuberculosis var. bovis Bacillus Calmette-Gurin. Purification and characterization of a novel fatty acid synthase, mycocerosic acid synthase, which elongates n-fatty acyl-CoA with methylmalonyl-CoA. J. Biol. Chem. 1985
    CitationMolecular cloning and sequencing of the gene for mycocerosic acid synthase, a novel fatty acid elongating multifunctional enzyme, from Mycobacterium tuberculosis var. bovis Bacillus Calmette-Guerin. M. Mathur & PE. Kolattukudy J. Biol. Chem. 1992njamshidiISS1527058See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers
    TermTBRXN:FASm240 fatty acid synthase - di-methyl lignoceric acid - ISSnjamshidiISS1527058See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers
    M. Mathur & PE. Kolattukudy Molecular cloning and sequencing of the gene for mycocerosic acid synthase, a novel fatty acid elongating multifunctional enzyme, from Mycobacterium tuberculosis var. bovis Bacillus Calmette-Guerin. J. Biol. Chem. 1992
    CitationFatty acid biosynthesis in Mycobacterium tuberculosis var. bovis Bacillus Calmette-Gurin. Purification and characterization of a novel fatty acid synthase, mycocerosic acid synthase, which elongates n-fatty acyl-CoA with methylmalonyl-CoA. authors,DL. Rainwater,PE. Kolattukudy J. Biol. Chem. 1985njamshidiISS3880746|1527058See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers
    TermTBRXN:FASm240 fatty acid synthase - di-methyl lignoceric acid - ISSnjamshidiISS1527058See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers
    authors,DL. Rainwater,PE. Kolattukudy Fatty acid biosynthesis in Mycobacterium tuberculosis var. bovis Bacillus Calmette-Gurin. Purification and characterization of a novel fatty acid synthase, mycocerosic acid synthase, which elongates n-fatty acyl-CoA with methylmalonyl-CoA. J. Biol. Chem. 1985
    CitationFatty acid biosynthesis in Mycobacterium tuberculosis var. bovis Bacillus Calmette-Gurin. Purification and characterization of a novel fatty acid synthase, mycocerosic acid synthase, which elongates n-fatty acyl-CoA with methylmalonyl-CoA. authors,DL. Rainwater,PE. Kolattukudy J. Biol. Chem. 1985njamshidiISS3880746|1527058See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers
    TermTBRXN:FASm240 fatty acid synthase - di-methyl lignoceric acid - ISSnjamshidiISS1527058See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers
    authors,DL. Rainwater,PE. Kolattukudy Fatty acid biosynthesis in Mycobacterium tuberculosis var. bovis Bacillus Calmette-Gurin. Purification and characterization of a novel fatty acid synthase, mycocerosic acid synthase, which elongates n-fatty acyl-CoA with methylmalonyl-CoA. J. Biol. Chem. 1985
    CitationMolecular cloning and sequencing of the gene for mycocerosic acid synthase, a novel fatty acid elongating multifunctional enzyme, from Mycobacterium tuberculosis var. bovis Bacillus Calmette-Guerin. M. Mathur & PE. Kolattukudy J. Biol. Chem. 1992njamshidiIDA1527058See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers
    TermTBRXN:FASm2402 fatty acid synthase - tri-methyl-lignoceric acid - IDAnjamshidiIDA1527058See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers
    M. Mathur & PE. Kolattukudy Molecular cloning and sequencing of the gene for mycocerosic acid synthase, a novel fatty acid elongating multifunctional enzyme, from Mycobacterium tuberculosis var. bovis Bacillus Calmette-Guerin. J. Biol. Chem. 1992
    CitationFatty acid biosynthesis in Mycobacterium tuberculosis var. bovis Bacillus Calmette-Gurin. Purification and characterization of a novel fatty acid synthase, mycocerosic acid synthase, which elongates n-fatty acyl-CoA with methylmalonyl-CoA. authors,DL. Rainwater,PE. Kolattukudy J. Biol. Chem. 1985njamshidiISS3880746|1527058See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers
    TermTBRXN:FASm2202 fatty acid synthase - di-methyl-behenic acid - ISSnjamshidiISS1527058See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers
    authors,DL. Rainwater,PE. Kolattukudy Fatty acid biosynthesis in Mycobacterium tuberculosis var. bovis Bacillus Calmette-Gurin. Purification and characterization of a novel fatty acid synthase, mycocerosic acid synthase, which elongates n-fatty acyl-CoA with methylmalonyl-CoA. J. Biol. Chem. 1985
    CitationFatty acid biosynthesis in Mycobacterium tuberculosis var. bovis Bacillus Calmette-Gurin. Purification and characterization of a novel fatty acid synthase, mycocerosic acid synthase, which elongates n-fatty acyl-CoA with methylmalonyl-CoA. authors,DL. Rainwater,PE. Kolattukudy J. Biol. Chem. 1985njamshidiISS3880746|1527058See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers
    TermTBRXN:FASm2202 fatty acid synthase - di-methyl-behenic acid - ISSnjamshidiISS1527058See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers
    authors,DL. Rainwater,PE. Kolattukudy Fatty acid biosynthesis in Mycobacterium tuberculosis var. bovis Bacillus Calmette-Gurin. Purification and characterization of a novel fatty acid synthase, mycocerosic acid synthase, which elongates n-fatty acyl-CoA with methylmalonyl-CoA. J. Biol. Chem. 1985
    CitationMolecular cloning and sequencing of the gene for mycocerosic acid synthase, a novel fatty acid elongating multifunctional enzyme, from Mycobacterium tuberculosis var. bovis Bacillus Calmette-Guerin. M. Mathur & PE. Kolattukudy J. Biol. Chem. 1992njamshidiIDA1527058See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers
    TermTBRXN:FASm240 fatty acid synthase - di-methyl lignoceric acid - IDAnjamshidiIDA1527058See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers
    M. Mathur & PE. Kolattukudy Molecular cloning and sequencing of the gene for mycocerosic acid synthase, a novel fatty acid elongating multifunctional enzyme, from Mycobacterium tuberculosis var. bovis Bacillus Calmette-Guerin. J. Biol. Chem. 1992
    CitationFatty acid biosynthesis in Mycobacterium tuberculosis var. bovis Bacillus Calmette-Gurin. Purification and characterization of a novel fatty acid synthase, mycocerosic acid synthase, which elongates n-fatty acyl-CoA with methylmalonyl-CoA. authors,DL. Rainwater,PE. Kolattukudy J. Biol. Chem. 1985njamshidiIDA3880746|1527058See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers
    TermTBRXN:FASm240 fatty acid synthase - di-methyl lignoceric acid - IDAnjamshidiIDA1527058See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers
    authors,DL. Rainwater,PE. Kolattukudy Fatty acid biosynthesis in Mycobacterium tuberculosis var. bovis Bacillus Calmette-Gurin. Purification and characterization of a novel fatty acid synthase, mycocerosic acid synthase, which elongates n-fatty acyl-CoA with methylmalonyl-CoA. J. Biol. Chem. 1985
    CitationFatty acid biosynthesis in Mycobacterium tuberculosis var. bovis Bacillus Calmette-Gurin. Purification and characterization of a novel fatty acid synthase, mycocerosic acid synthase, which elongates n-fatty acyl-CoA with methylmalonyl-CoA. authors,DL. Rainwater,PE. Kolattukudy J. Biol. Chem. 1985njamshidiIDA3880746|1527058See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers
    TermTBRXN:FASm220 fatty acid synthase - methyl-behenic acid - ISSnjamshidiISS1527058See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers
    authors,DL. Rainwater,PE. Kolattukudy Fatty acid biosynthesis in Mycobacterium tuberculosis var. bovis Bacillus Calmette-Gurin. Purification and characterization of a novel fatty acid synthase, mycocerosic acid synthase, which elongates n-fatty acyl-CoA with methylmalonyl-CoA. J. Biol. Chem. 1985
    CitationMolecular cloning and sequencing of the gene for mycocerosic acid synthase, a novel fatty acid elongating multifunctional enzyme, from Mycobacterium tuberculosis var. bovis Bacillus Calmette-Guerin. M. Mathur & PE. Kolattukudy J. Biol. Chem. 1992njamshidiIDA1527058See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers
    TermTBRXN:FASm2202 fatty acid synthase - di-methyl-behenic acid - IDAnjamshidiIDA1527058See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers
    M. Mathur & PE. Kolattukudy Molecular cloning and sequencing of the gene for mycocerosic acid synthase, a novel fatty acid elongating multifunctional enzyme, from Mycobacterium tuberculosis var. bovis Bacillus Calmette-Guerin. J. Biol. Chem. 1992
    CitationFatty acid biosynthesis in Mycobacterium tuberculosis var. bovis Bacillus Calmette-Gurin. Purification and characterization of a novel fatty acid synthase, mycocerosic acid synthase, which elongates n-fatty acyl-CoA with methylmalonyl-CoA. authors,DL. Rainwater,PE. Kolattukudy J. Biol. Chem. 1985njamshidiIDA3880746|1527058See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers
    TermTBRXN:FASm2202 fatty acid synthase - di-methyl-behenic acid - IDAnjamshidiIDA1527058See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers
    authors,DL. Rainwater,PE. Kolattukudy Fatty acid biosynthesis in Mycobacterium tuberculosis var. bovis Bacillus Calmette-Gurin. Purification and characterization of a novel fatty acid synthase, mycocerosic acid synthase, which elongates n-fatty acyl-CoA with methylmalonyl-CoA. J. Biol. Chem. 1985
    CitationFatty acid biosynthesis in Mycobacterium tuberculosis var. bovis Bacillus Calmette-Gurin. Purification and characterization of a novel fatty acid synthase, mycocerosic acid synthase, which elongates n-fatty acyl-CoA with methylmalonyl-CoA. authors,DL. Rainwater,PE. Kolattukudy J. Biol. Chem. 1985njamshidiIDA3880746|1527058See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers
    TermTBRXN:FASm2202 fatty acid synthase - di-methyl-behenic acid - IDAnjamshidiIDA1527058See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers
    authors,DL. Rainwater,PE. Kolattukudy Fatty acid biosynthesis in Mycobacterium tuberculosis var. bovis Bacillus Calmette-Gurin. Purification and characterization of a novel fatty acid synthase, mycocerosic acid synthase, which elongates n-fatty acyl-CoA with methylmalonyl-CoA. J. Biol. Chem. 1985
    CitationMolecular cloning and sequencing of the gene for mycocerosic acid synthase, a novel fatty acid elongating multifunctional enzyme, from Mycobacterium tuberculosis var. bovis Bacillus Calmette-Guerin. M. Mathur & PE. Kolattukudy J. Biol. Chem. 1992njamshidiISS1527058See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers
    TermTBRXN:FASm2202 fatty acid synthase - di-methyl-behenic acid - ISSnjamshidiISS1527058See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers
    M. Mathur & PE. Kolattukudy Molecular cloning and sequencing of the gene for mycocerosic acid synthase, a novel fatty acid elongating multifunctional enzyme, from Mycobacterium tuberculosis var. bovis Bacillus Calmette-Guerin. J. Biol. Chem. 1992
    CitationFatty acid biosynthesis in Mycobacterium tuberculosis var. bovis Bacillus Calmette-Gurin. Purification and characterization of a novel fatty acid synthase, mycocerosic acid synthase, which elongates n-fatty acyl-CoA with methylmalonyl-CoA. authors,DL. Rainwater,PE. Kolattukudy J. Biol. Chem. 1985njamshidiIDA3880746|1527058See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers
    TermTBRXN:FASm220 fatty acid synthase - methyl-behenic acid - IDAnjamshidiIDA1527058See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers
    authors,DL. Rainwater,PE. Kolattukudy Fatty acid biosynthesis in Mycobacterium tuberculosis var. bovis Bacillus Calmette-Gurin. Purification and characterization of a novel fatty acid synthase, mycocerosic acid synthase, which elongates n-fatty acyl-CoA with methylmalonyl-CoA. J. Biol. Chem. 1985
    CitationFatty acid biosynthesis in Mycobacterium tuberculosis var. bovis Bacillus Calmette-Gurin. Purification and characterization of a novel fatty acid synthase, mycocerosic acid synthase, which elongates n-fatty acyl-CoA with methylmalonyl-CoA. authors,DL. Rainwater,PE. Kolattukudy J. Biol. Chem. 1985njamshidiIDA3880746|1527058See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers
    TermTBRXN:FASm220 fatty acid synthase - methyl-behenic acid - IDAnjamshidiIDA1527058See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers
    authors,DL. Rainwater,PE. Kolattukudy Fatty acid biosynthesis in Mycobacterium tuberculosis var. bovis Bacillus Calmette-Gurin. Purification and characterization of a novel fatty acid synthase, mycocerosic acid synthase, which elongates n-fatty acyl-CoA with methylmalonyl-CoA. J. Biol. Chem. 1985
    CitationMolecular cloning and sequencing of the gene for mycocerosic acid synthase, a novel fatty acid elongating multifunctional enzyme, from Mycobacterium tuberculosis var. bovis Bacillus Calmette-Guerin. M. Mathur & PE. Kolattukudy J. Biol. Chem. 1992njamshidiISS1527058See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers
    TermTBRXN:FASm220 fatty acid synthase - methyl-behenic acid - ISSnjamshidiISS1527058See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers
    M. Mathur & PE. Kolattukudy Molecular cloning and sequencing of the gene for mycocerosic acid synthase, a novel fatty acid elongating multifunctional enzyme, from Mycobacterium tuberculosis var. bovis Bacillus Calmette-Guerin. J. Biol. Chem. 1992
    CitationFatty acid biosynthesis in Mycobacterium tuberculosis var. bovis Bacillus Calmette-Gurin. Purification and characterization of a novel fatty acid synthase, mycocerosic acid synthase, which elongates n-fatty acyl-CoA with methylmalonyl-CoA. authors,DL. Rainwater,PE. Kolattukudy J. Biol. Chem. 1985njamshidiISS3880746|1527058See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers
    TermTBRXN:FASm220 fatty acid synthase - methyl-behenic acid - ISSnjamshidiISS1527058See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers
    authors,DL. Rainwater,PE. Kolattukudy Fatty acid biosynthesis in Mycobacterium tuberculosis var. bovis Bacillus Calmette-Gurin. Purification and characterization of a novel fatty acid synthase, mycocerosic acid synthase, which elongates n-fatty acyl-CoA with methylmalonyl-CoA. J. Biol. Chem. 1985
    CitationFatty acid biosynthesis in Mycobacterium tuberculosis var. bovis Bacillus Calmette-Gurin. Purification and characterization of a novel fatty acid synthase, mycocerosic acid synthase, which elongates n-fatty acyl-CoA with methylmalonyl-CoA. authors,DL. Rainwater,PE. Kolattukudy J. Biol. Chem. 1985njamshidiISS3880746|1527058See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers
    CitationMolecular cloning and sequencing of the gene for mycocerosic acid synthase, a novel fatty acid elongating multifunctional enzyme, from Mycobacterium tuberculosis var. bovis Bacillus Calmette-Guerin. M. Mathur & PE. Kolattukudy J. Biol. Chem. 1992njamshidiIDA1527058See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers
    TermTBRXN:FASm220 fatty acid synthase - methyl-behenic acid - IDAnjamshidiIDA1527058See PMID: 1527058 and 3880746. PMID 3880746 noted that multi-functional mas gene did not appear to be steroselective functional enzyme composed of two identical monomers
    M. Mathur & PE. Kolattukudy Molecular cloning and sequencing of the gene for mycocerosic acid synthase, a novel fatty acid elongating multifunctional enzyme, from Mycobacterium tuberculosis var. bovis Bacillus Calmette-Guerin. J. Biol. Chem. 1992
    CitationAn acyl-CoA synthase (acoas) gene adjacent to the mycocerosic acid synthase (mas) locus is necessary for mycocerosyl lipid synthesis in Mycobacterium tuberculosis var. bovis BCG. AM. Fitzmaurice & PE. Kolattukudy J. Biol. Chem. 1998shahanup86IMP9525903Affinity purification (Physical interaction)
    InteractionPhysicalInteraction Rv2941shahanup86IMPAffinity purification (Physical interaction)
    AM. Fitzmaurice & PE. Kolattukudy An acyl-CoA synthase (acoas) gene adjacent to the mycocerosic acid synthase (mas) locus is necessary for mycocerosyl lipid synthesis in Mycobacterium tuberculosis var. bovis BCG. J. Biol. Chem. 1998
    InteractionRegulatedBy Rv3911yamir.morenoIEPMicroarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
    S. Raman, X. Puyang et al. Mycobacterium tuberculosis SigM positively regulates Esx secreted protein and nonribosomal peptide synthetase genes and down regulates virulence-associated surface lipid synthesis. J. Bacteriol. 2006
    InteractionRegulatedBy Rv0981yamir.morenoIEPMicroarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
    H. He, R. Hovey et al. MprAB is a stress-responsive two-component system that directly regulates expression of sigma factors SigB and SigE in Mycobacterium tuberculosis. J. Bacteriol. 2006
    InteractionRegulatedBy Rv1221yamir.morenoIEPMicroarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
    R. Manganelli, MI. Voskuil et al. The Mycobacterium tuberculosis ECF sigma factor sigmaE: role in global gene expression and survival in macrophages. Mol. Microbiol. 2001
    NameMycocerosic acid synthase (type I polyketide synthase) involved in the biosynthesis of phthiocerol dimycocerosates and phenolic glycolipidsmjacksonIMPPhthiocerol dimycocerosates (PDIM), phenolic glycolipids (PGL) and para-hydroxybenzoic acid derivatives
    NameMycocerosic acid synthase (type I polyketide synthase) involved in the biosynthesis of phthiocerol dimycocerosates and phenolic glycolipidsmjacksonIDAPhthiocerol dimycocerosates (PDIM), phenolic glycolipids (PGL) and para-hydroxybenzoic acid derivatives
    CitationSynthesis of mycocerosic acids from methylmalonyl coenzyme A by cell-free extracts of Mycobacterium tuberculosis var. bovis BCG. authors,DL. Rainwater,PE. Kolattukudy J. Biol. Chem. 1983mjackson6402506Mycocerosic acid synthase (type I polyketide synthase) involved in the biosynthesis of phthiocerol dimycocerosates and phenolic glycolipids (phenotypic [mycobacterial recombinant strains]; enzymatic)
    OtherTBPWY:Phthiocerol dimycocerosates, PGL & pHBADmjacksonMycocerosic acid synthase (type I polyketide synthase) involved in the biosynthesis of phthiocerol dimycocerosates and phenolic glycolipids (phenotypic [mycobacterial recombinant strains]; enzymatic)
    authors,DL. Rainwater,PE. Kolattukudy Synthesis of mycocerosic acids from methylmalonyl coenzyme A by cell-free extracts of Mycobacterium tuberculosis var. bovis BCG. J. Biol. Chem. 1983
    CitationMolecular cloning and sequencing of the gene for mycocerosic acid synthase, a novel fatty acid elongating multifunctional enzyme, from Mycobacterium tuberculosis var. bovis Bacillus Calmette-Guerin. M. Mathur & PE. Kolattukudy J. Biol. Chem. 1992mjackson1527058Mycocerosic acid synthase (type I polyketide synthase) involved in the biosynthesis of phthiocerol dimycocerosates and phenolic glycolipids (phenotypic [mycobacterial recombinant strains]; enzymatic)
    OtherTBPWY:Phthiocerol dimycocerosates, PGL & pHBADmjacksonMycocerosic acid synthase (type I polyketide synthase) involved in the biosynthesis of phthiocerol dimycocerosates and phenolic glycolipids (phenotypic [mycobacterial recombinant strains]; enzymatic)
    M. Mathur & PE. Kolattukudy Molecular cloning and sequencing of the gene for mycocerosic acid synthase, a novel fatty acid elongating multifunctional enzyme, from Mycobacterium tuberculosis var. bovis Bacillus Calmette-Guerin. J. Biol. Chem. 1992
    CitationTargeted replacement of the mycocerosic acid synthase gene in Mycobacterium bovis BCG produces a mutant that lacks mycosides. authors,AK. Azad,TD. Sirakova,LM. Rogers,PE. Kolattukudy Proc. Natl. Acad. Sci. U.S.A. 1996mjackson8643481Mycocerosic acid synthase (type I polyketide synthase) involved in the biosynthesis of phthiocerol dimycocerosates and phenolic glycolipids (phenotypic [mycobacterial recombinant strains]; enzymatic)
    OtherTBPWY:Phthiocerol dimycocerosates, PGL & pHBADmjacksonMycocerosic acid synthase (type I polyketide synthase) involved in the biosynthesis of phthiocerol dimycocerosates and phenolic glycolipids (phenotypic [mycobacterial recombinant strains]; enzymatic)
    authors,AK. Azad,TD. Sirakova,LM. Rogers,PE. Kolattukudy Targeted replacement of the mycocerosic acid synthase gene in Mycobacterium bovis BCG produces a mutant that lacks mycosides. Proc. Natl. Acad. Sci. U.S.A. 1996
    CitationFatty acid biosynthesis in Mycobacterium tuberculosis var. bovis Bacillus Calmette-Gurin. Purification and characterization of a novel fatty acid synthase, mycocerosic acid synthase, which elongates n-fatty acyl-CoA with methylmalonyl-CoA. authors,DL. Rainwater,PE. Kolattukudy J. Biol. Chem. 1985mjackson3880746Mycocerosic acid synthase (type I polyketide synthase) involved in the biosynthesis of phthiocerol dimycocerosates and phenolic glycolipids (phenotypic [mycobacterial recombinant strains]; enzymatic)
    OtherTBPWY:Phthiocerol dimycocerosates, PGL & pHBADmjacksonMycocerosic acid synthase (type I polyketide synthase) involved in the biosynthesis of phthiocerol dimycocerosates and phenolic glycolipids (phenotypic [mycobacterial recombinant strains]; enzymatic)
    authors,DL. Rainwater,PE. Kolattukudy Fatty acid biosynthesis in Mycobacterium tuberculosis var. bovis Bacillus Calmette-Gurin. Purification and characterization of a novel fatty acid synthase, mycocerosic acid synthase, which elongates n-fatty acyl-CoA with methylmalonyl-CoA. J. Biol. Chem. 1985
    CitationDissecting the mechanism and assembly of a complex virulence mycobacterial lipid. OA. Trivedi, P. Arora et al. Mol. Cell 2005mjackson15749014Mycocerosic acid synthase (type I polyketide synthase) involved in the biosynthesis of phthiocerol dimycocerosates and phenolic glycolipids (phenotypic [mycobacterial recombinant strains]; enzymatic)
    OtherTBPWY:Phthiocerol dimycocerosates, PGL & pHBADmjacksonMycocerosic acid synthase (type I polyketide synthase) involved in the biosynthesis of phthiocerol dimycocerosates and phenolic glycolipids (phenotypic [mycobacterial recombinant strains]; enzymatic)
    OA. Trivedi, P. Arora et al. Dissecting the mechanism and assembly of a complex virulence mycobacterial lipid. Mol. Cell 2005

    Comments