TB Genome Annotation Portal

Rv2936 (drrA)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: doxorubicin resistance ATP-binding protein DrrA
  • REFSEQ: daunorubicin-DIM-transport ATP-binding protein ABC transporter DrrA
  • PATRIC: Daunorubicin-DIM-transport ATP-binding protein ABC transporter DrrA
  • TUBERCULIST: Daunorubicin-dim-transport ATP-binding protein ABC transporter DrrA
  • NCBI: Daunorubicin-dim-transport ATP-binding protein ABC transporter DrrA
  • updated information (H37Rv4):
    • gene name: drrA
    • function:
    • reference:
• Type: Not Target
• Start: 3272214
• End: 3273209
• Operon:


• Trans-membrane region:
  
• Role: III.A.6 - Efflux proteins
• GO terms:
  • GO:1900753 - doxorubicin transport (Uniprot)
  • GO:0055085 - transmembrane transport (Uniprot)
  • GO:0046677 - response to antibiotic (Uniprot)
  • GO:0044119 - growth of symbiont in host cell (Uniprot)
  • GO:0043215 - daunorubicin transport (Uniprot)
  • GO:0016887 - ATPase activity (Uniprot)
  • GO:0016787 - hydrolase activity (Uniprot)
  • GO:0016020 - membrane (Uniprot)
  • GO:0006869 - lipid transport (Uniprot)
  • GO:0005886 - plasma membrane (Uniprot)
  • GO:0005618 - cell wall (Uniprot)
  • GO:0005524 - ATP binding (Uniprot)
  • GO:0000166 - nucleotide binding (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure:
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020):
  

  PDB	aa ident	species	PDB title
  4YER	38%	Thermotoga maritima	Crystal structure of an ABC transporter ATP-binding protein (TM_1403) from Thermotoga maritima MSB8 at 2.35 A resolution
  1VPL	37%	Thermotoga maritima	Crystal structure of ABC transporter ATP-binding protein (TM0544) from Thermotoga maritima at 2.10 A resolution
  6S8N	35%	Shigella flexneri	Cryo-EM structure of LptB2FGC in complex with lipopolysaccharide
  6S8H	35%	Shigella flexneri	Cryo-EM structure of LptB2FG in complex with LPS
  6S8G	35%	Shigella flexneri	Cryo-EM structure of LptB2FGC in complex with AMP-PNP
  6MI8	35%	Escherichia coli (strain K12)	Cryo-EM Structure of vanadate-trapped E.coli LptB2FGC
  6MI7	35%	Escherichia coli (strain K12)	Nucleotide-free Cryo-EM Structure of E.coli LptB2FGC
  6MHZ	35%	Escherichia coli (strain K12)	Vanadate trapped Cryo-EM Structure of E.coli LptB2FG Transporter
  6MHU	35%	Escherichia coli (strain K12)	Nucleotide-free Cryo-EM Structure of E.coli LptB2FG Transporter
  6MGF	35%	Escherichia coli (strain K12)	untagged, wild-type LptB in complex with ADP

• Links to additional information on drrA:
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = 1.521 (from Jeremy Rock's lab)
  • KEGG - nucleotide and amino acid sequences of gene
  • Mycobrowser
  • PATRIC
  • BioCyc
  • Systems Biology

Amino Acid Sequence

MRNDDMAVVVNGVRKTYGKGKIVALDDVSFKVRRGEVIGLLGPNGAGKTTMVDILSTLTRPDAGSAIIAGYDVVSEPAGVRRSIMVTGQQVAVDDALSGE
QNLVLFGRLWGLSKSAARKRAAELLEQFSLVHAGKRRVGTYSGGMRRRIDIACGLVVQPQVAFLDEPTTGLDPRSRQAIWDLVASFKKLGIATLLTTQYL
EEADALSDRIILIDHGIIIAEGTANELKHRAGDTFCEIVPRDLKDLDAIVAALGSLLPEHHRAMLTPDSDRITMPAPDGIRMLVEAARRIDEARIELADI
ALRRPSLDHVFLAMTTDPTESLTHLVSGSAR

Additional Information

Analysis of Positive Selection in Clinical Isolates *new*

• Analysis of dN/dS (omega) in two collections of Mtb clinical isolates using GenomegaMap (Window model) (see description of methods)
  • Moldova: 2,057 clinical isolates
  • global set: 5,195 clinical isolates from 15 other countries
• In the omega plots, the black line shows the mean estimate of omega (dN/dS) at each codon, and the blue lines are the bounds for the 95% credible interval (95%CI, from MCMC sampling).
• A gene is under significant positive selection if the lower-bound of the 95%CI of omega (lower blue line) exceeds 1.0 at any codon.

	Moldova (2,057)	global set (5,195)
under significant positive selection?	NO	NO
omega peak height (95%CI lower bound)	1.78 (0.3)	1.35 (0.49)
codons under selection
omega plots
genetic variants*	link	link
statistics at each codon	link	link