TB Genome Annotation Portal

Rv2928 (tesA)

Amino Acid Sequence

MLARHGPRYGGSVNGHSDDSSGDAKQAAPTLYIFPHAGGTAKDYVAFSREFSADVKRIAVQYPGQHDRSGLPPLESIPTLADEIFAMMKPSARIDDPVAF
FGHSMGGMLAFEVALRYQSAGHRVLAFFVSACSAPGHIRYKQLQDLSDREMLDLFTRMTGMNPDFFTDDEFFVGALPTLRAVRAIAGYSCPPETKLSCPI
YAFIGDKDWIATQDDMDPWRDRTTEEFSIRVFPGDHFYLNDNLPELVSDIEDKTLQWHDRA
(Nucleotide sequence available on KEGG)

Additional Information



ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across >100 conditions *new*

Classification Condition Strain Method Reference Notes
Uncertain Sodium Oleate H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: 0.929250;
11 non-insertions in a row out of 26 sites
Uncertain Lignoceric Acid H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: 0.950950;
10 non-insertions in a row out of 26 sites
Uncertain Phosphatidylcholine H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: 0.966250;
10 non-insertions in a row out of 26 sites
Non-Essential minimal media + 0.1% glycerol H37RvMA Gumbel Griffin et al. (2011) Probability of Essentiality: 0.000150;
7 non-insertions in a row out of 27 sites
Non-Essential minimal media + 0.01% cholesterol H37RvMA Gumbel Griffin et al. (2011) Probability of Essentiality: 0.000000;
4 non-insertions in a row out of 27 sites
Non-Essential 7H10-glycerol H37RvMA TraSH Sassetti et al. (2003a)
Non-Essential C57BL/6J mice (8 weeks) H37RvMA TraSH Sassetti et al. (2003b) Hybridization Ratio: 0.5
Non-Essential 7H09/7H10 + rich media H37RvMA MotifHMM DeJesus et al. (2017) Fully saturated (14 reps).

TnSeq Data No data currently available.
  • No TnSeq data currently available for this Target.
RNASeq Data No data currently available.
  • No RNA-Seq data currently available for this Target.
Metabolomic Profiles No data currently available.
  • No Metabolomic data currently available for this Target.
Proteomic Data No data currently available.
  • No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology
  • BioCyc

    Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

    NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

    Interactions based on ChIPSeq data

  • Interactions based on ChIPSeq data (Minch et al. 2014)

    • Binds To:

      • No bindings to other targets were found.
    • Bound By:

    Interactions based on TFOE data (Rustad et al. 2014)



    TBCAP

    Tubculosis Community Annotation Project (
    Slayden et al., 2013)

    Rv2928 (tesA)

    PropertyValueCreatorEvidencePMIDComment
    TermTBRXN:PREPHACPH fatty-acyl-ACP hydrolase - ISSnjamshidiISS15668773for phthiocerol chain synthesis, see PMID: 15668773
    A. Rao & A. Ranganathan Interaction studies on proteins encoded by the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. Mol. Genet. Genomics 2004
    CitationInteraction studies on proteins encoded by the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. A. Rao & A. Ranganathan Mol. Genet. Genomics 2004njamshidiIPI15668773for phthiocerol chain synthesis, see PMID: 15668773
    TermEC:3.1.2.14 Oleoyl-[acyl-carrier-protein] hydrolase. - IPInjamshidiIPI15668773for phthiocerol chain synthesis, see PMID: 15668773
    A. Rao & A. Ranganathan Interaction studies on proteins encoded by the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. Mol. Genet. Genomics 2004
    TermTBRXN:PREPHACPH fatty-acyl-ACP hydrolase - IPInjamshidiIPI15668773for phthiocerol chain synthesis, see PMID: 15668773
    A. Rao & A. Ranganathan Interaction studies on proteins encoded by the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. Mol. Genet. Genomics 2004
    CitationInteraction studies on proteins encoded by the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. A. Rao & A. Ranganathan Mol. Genet. Genomics 2004njamshidiISS15668773for phthiocerol chain synthesis, see PMID: 15668773
    TermEC:3.1.2.14 Oleoyl-[acyl-carrier-protein] hydrolase. - ISSnjamshidiISS15668773for phthiocerol chain synthesis, see PMID: 15668773
    A. Rao & A. Ranganathan Interaction studies on proteins encoded by the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. Mol. Genet. Genomics 2004
    TermTBRXN:PREPPACPH fatty-acyl-ACP hydrolase - ISSnjamshidiISS15668773for phthiocerol chain synthesis, see PMID: 15668773
    A. Rao & A. Ranganathan Interaction studies on proteins encoded by the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. Mol. Genet. Genomics 2004
    CitationInteraction studies on proteins encoded by the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. A. Rao & A. Ranganathan Mol. Genet. Genomics 2004njamshidiIPI15668773for phthiocerol chain synthesis, see PMID: 15668773
    TermEC:3.1.2.14 Oleoyl-[acyl-carrier-protein] hydrolase. - IPInjamshidiIPI15668773for phthiocerol chain synthesis, see PMID: 15668773
    A. Rao & A. Ranganathan Interaction studies on proteins encoded by the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. Mol. Genet. Genomics 2004
    TermTBRXN:PREPPACPH fatty-acyl-ACP hydrolase - IPInjamshidiIPI15668773for phthiocerol chain synthesis, see PMID: 15668773
    A. Rao & A. Ranganathan Interaction studies on proteins encoded by the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. Mol. Genet. Genomics 2004
    CitationInteraction studies on proteins encoded by the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. A. Rao & A. Ranganathan Mol. Genet. Genomics 2004njamshidiISS15668773for phthiocerol chain synthesis, see PMID: 15668773
    TermEC:3.1.2.14 Oleoyl-[acyl-carrier-protein] hydrolase. - ISSnjamshidiISS15668773for phthiocerol chain synthesis, see PMID: 15668773
    A. Rao & A. Ranganathan Interaction studies on proteins encoded by the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. Mol. Genet. Genomics 2004
    CitationInteraction studies on proteins encoded by the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. A. Rao & A. Ranganathan Mol. Genet. Genomics 2004razeeth.newIPI15668773two-hybrid (Physical interaction)
    InteractionPhysicalInteraction Rv2935razeeth.newIPItwo-hybrid (Physical interaction)
    A. Rao & A. Ranganathan Interaction studies on proteins encoded by the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. Mol. Genet. Genomics 2004
    CitationLong-chain multiple methyl-branched fatty acid-containing lipids of Mycobacterium tuberculosis: biosynthesis, transport, regulation and biological activities. authors,M. Jackson,G. Stadthagen,B. Gicquel Tuberculosis (Edinb) 2007razeeth.newIPI17030019two-hybrid (Physical interaction)
    InteractionPhysicalInteraction Rv2935razeeth.newIPItwo-hybrid (Physical interaction)
    authors,M. Jackson,G. Stadthagen,B. Gicquel Long-chain multiple methyl-branched fatty acid-containing lipids of Mycobacterium tuberculosis: biosynthesis, transport, regulation and biological activities. Tuberculosis (Edinb) 2007
    InteractionRegulatedBy Rv0348yamir.morenoIEPMicroarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
    B. Abomoelak, EA. Hoye et al. mosR, a novel transcriptional regulator of hypoxia and virulence in Mycobacterium tuberculosis. J. Bacteriol. 2009
    NameType II thioesterase thought to be involved in the release of phthiocerol and phenolphthiocerol from PpsE in the biosynthesis of phthiocerol dimycocerosates and phenolic glycolipidsmjacksonIMPPhthiocerol dimycocerosates (PDIM), phenolic glycolipids (PGL) and para-hydroxybenzoic acid derivatives
    OtherTBPWY:Phthiocerol dimycocerosates, PGL & pHBADmjacksonType II thioesterase thought to be involved in the release of phthiocerol and phenolphthiocerol from PpsE in the biosynthesis of phthiocerol dimycocerosates and phenolic glycolipids (phenotypic [mycobacterial recombinant strains])
    SJ. Waddell, GA. Chung et al. Inactivation of polyketide synthase and related genes results in the loss of complex lipids in Mycobacterium tuberculosis H37Rv. Lett. Appl. Microbiol. 2005
    CitationInactivation of tesA reduces cell wall lipid production and increases drug susceptibility in mycobacteria. authors,SS. Chavadi,UR. Edupuganti,O. Vergnolle,I. Fatima,SM. Singh,CE. Soll,LE. Quadri J. Biol. Chem. 2011mjackson21592957Type II thioesterase thought to be involved in the release of phthiocerol and phenolphthiocerol from PpsE in the biosynthesis of phthiocerol dimycocerosates and phenolic glycolipids (phenotypic [mycobacterial recombinant strains])
    OtherTBPWY:Phthiocerol dimycocerosates, PGL & pHBADmjacksonType II thioesterase thought to be involved in the release of phthiocerol and phenolphthiocerol from PpsE in the biosynthesis of phthiocerol dimycocerosates and phenolic glycolipids (phenotypic [mycobacterial recombinant strains])
    authors,SS. Chavadi,UR. Edupuganti,O. Vergnolle,I. Fatima,SM. Singh,CE. Soll,LE. Quadri Inactivation of tesA reduces cell wall lipid production and increases drug susceptibility in mycobacteria. J. Biol. Chem. 2011
    CitationA Mycobacterium marinum TesA mutant defective for major cell wall-associated lipids is highly attenuated in Dictyostelium discoideum and zebrafish embryos. authors,L. Alibaud,Y. Rombouts,X. Trivelli,A. Burguire,SL. Cirillo,JD. Cirillo,JF. Dubremetz,Y. Gurardel,G. Lutfalla,L. Kremer Mol. Microbiol. 2011mjackson21375593Type II thioesterase thought to be involved in the release of phthiocerol and phenolphthiocerol from PpsE in the biosynthesis of phthiocerol dimycocerosates and phenolic glycolipids (phenotypic [mycobacterial recombinant strains])
    OtherTBPWY:Phthiocerol dimycocerosates, PGL & pHBADmjacksonType II thioesterase thought to be involved in the release of phthiocerol and phenolphthiocerol from PpsE in the biosynthesis of phthiocerol dimycocerosates and phenolic glycolipids (phenotypic [mycobacterial recombinant strains])
    authors,L. Alibaud,Y. Rombouts,X. Trivelli,A. Burguire,SL. Cirillo,JD. Cirillo,JF. Dubremetz,Y. Gurardel,G. Lutfalla,L. Kremer A Mycobacterium marinum TesA mutant defective for major cell wall-associated lipids is highly attenuated in Dictyostelium discoideum and zebrafish embryos. Mol. Microbiol. 2011
    CitationInteraction studies on proteins encoded by the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. A. Rao & A. Ranganathan Mol. Genet. Genomics 2004mjackson15668773Type II thioesterase thought to be involved in the release of phthiocerol and phenolphthiocerol from PpsE in the biosynthesis of phthiocerol dimycocerosates and phenolic glycolipids (phenotypic [mycobacterial recombinant strains])
    OtherTBPWY:Phthiocerol dimycocerosates, PGL & pHBADmjacksonType II thioesterase thought to be involved in the release of phthiocerol and phenolphthiocerol from PpsE in the biosynthesis of phthiocerol dimycocerosates and phenolic glycolipids (phenotypic [mycobacterial recombinant strains])
    A. Rao & A. Ranganathan Interaction studies on proteins encoded by the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. Mol. Genet. Genomics 2004
    CitationInactivation of polyketide synthase and related genes results in the loss of complex lipids in Mycobacterium tuberculosis H37Rv. SJ. Waddell, GA. Chung et al. Lett. Appl. Microbiol. 2005mjackson15715645Type II thioesterase thought to be involved in the release of phthiocerol and phenolphthiocerol from PpsE in the biosynthesis of phthiocerol dimycocerosates and phenolic glycolipids (phenotypic [mycobacterial recombinant strains])

    Comments