TB Genome Annotation Portal

Rv2928 (tesA)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: hypothetical protein
  • REFSEQ: thioesterase TESA
  • PATRIC: Thioesterase TesA
  • TUBERCULIST: Probable thioesterase TesA
  • NCBI: Probable thioesterase TesA
  • updated information (H37Rv4):
    • gene name: tesA
    • function:
    • reference:
• Type: Not Target
• Start: 3242198
• End: 3242983
• Operon:


• Trans-membrane region:
  
• Role: I.I - Polyketide and non-ribosomal peptide synthesis
• GO terms:
  • GO:0071770 - DIM/DIP cell wall layer assembly (Uniprot)
  • GO:0052562 - negative regulation by symbiont of host immune response (Uniprot)
  • GO:0016788 - hydrolase activity, acting on ester bonds (Uniprot)
  • GO:0016787 - hydrolase activity (Uniprot)
  • GO:0009058 - biosynthetic process (Uniprot)
  • GO:0008610 - lipid biosynthetic process (Uniprot)
  • GO:0005886 - plasma membrane (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
  • PREPPHTHACP[c] -> H[c] + ACP[c] + PREPPHTH[c]
  • PREPHTHACP[c] -> H[c] + ACP[c] + PREPHTH[c]
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure:
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020):
  

  PDB	aa ident	species	PDB title
  6FW5	100%	Mycobacterium tuberculosis CDC1551	TesA a major thioesterase from Mycobacterium tuberculosis
  6FVJ	100%	Mycobacterium tuberculosis	TesA a major thioesterase from Mycobacterium tuberculosis
  6VAP	39%	Streptomyces sp. WAC02707	Structure of the type II thioesterase BorB from the borrelidin biosynthetic cluster

• Links to additional information on tesA:
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = 1.409 (from Jeremy Rock's lab)
  • KEGG - nucleotide and amino acid sequences of gene
  • Mycobrowser
  • PATRIC
  • BioCyc
  • Systems Biology

Amino Acid Sequence

MLARHGPRYGGSVNGHSDDSSGDAKQAAPTLYIFPHAGGTAKDYVAFSREFSADVKRIAVQYPGQHDRSGLPPLESIPTLADEIFAMMKPSARIDDPVAF
FGHSMGGMLAFEVALRYQSAGHRVLAFFVSACSAPGHIRYKQLQDLSDREMLDLFTRMTGMNPDFFTDDEFFVGALPTLRAVRAIAGYSCPPETKLSCPI
YAFIGDKDWIATQDDMDPWRDRTTEEFSIRVFPGDHFYLNDNLPELVSDIEDKTLQWHDRA

Additional Information

Analysis of Positive Selection in Clinical Isolates *new*

• Analysis of dN/dS (omega) in two collections of Mtb clinical isolates using GenomegaMap (Window model) (see description of methods)
  • Moldova: 2,057 clinical isolates
  • global set: 5,195 clinical isolates from 15 other countries
• In the omega plots, the black line shows the mean estimate of omega (dN/dS) at each codon, and the blue lines are the bounds for the 95% credible interval (95%CI, from MCMC sampling).
• A gene is under significant positive selection if the lower-bound of the 95%CI of omega (lower blue line) exceeds 1.0 at any codon.

	Moldova (2,057)	global set (5,195)
under significant positive selection?	NO	NO
omega peak height (95%CI lower bound)	2.17 (0.51)	1.98 (0.51)
codons under selection
omega plots
genetic variants*	link	link
statistics at each codon	link	link