TB Genome Annotation Portal

Rv2928 (tesA)

Amino Acid Sequence

MLARHGPRYGGSVNGHSDDSSGDAKQAAPTLYIFPHAGGTAKDYVAFSREFSADVKRIAVQYPGQHDRSGLPPLESIPTLADEIFAMMKPSARIDDPVAF
FGHSMGGMLAFEVALRYQSAGHRVLAFFVSACSAPGHIRYKQLQDLSDREMLDLFTRMTGMNPDFFTDDEFFVGALPTLRAVRAIAGYSCPPETKLSCPI
YAFIGDKDWIATQDDMDPWRDRTTEEFSIRVFPGDHFYLNDNLPELVSDIEDKTLQWHDRA
(Nucleotide sequence available on KEGG)

Additional Information



ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across ~100 conditions

Rv2928/tesA, gene len: 785 bp, num TA sites: 27
conditiondatasetcallmediummethodnotes
in-vitroDeJesus 2017 mBionon-essential7H9HMMfully saturated, 14 TnSeq libraries combined
in-vitroSassetti 2003 Mol Micronon-essential 7H9TRASHessential if hybridization ratio<0.2
in-vivo (mice)Sassetti 2003 PNASnon-essential BL6 miceTRASHessential if hybridization ratio<0.4, min over 4 timepoints (1-8 weeks)
in-vitro (glycerol)Griffin 2011 PPathnon-essentialM9 minimal+glycerolGumbel2 replicates; Padj<0.05
in-vitro (cholesterol)Griffin 2011 PPathnon-essentialM9 minimal+cholesterolGumbel3 replicates; Padj<0.05
differentially essential in cholesterol Griffin 2011 PPathNO (LFC=0.9)cholesterol vs glycerolresampling-SRYES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in cholesterol
in-vitroSmith 2022 eLifegrowth defect7H9HMM6 replicates (raw data in Subramaniam 2017, PMID 31752678)
in-vivo (mice)Smith 2022 eLifegrowth defectBL6 miceHMM6 replicates (raw data in Subramaniam 2017, PMID 31752678)
differentially essential in miceSmith 2022 eLifeNO (LFC=0.345)in-vivo vs in-vitroZINBYES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in mice
in-vitro (minimal)Minato 2019 mSysnon-essentialminimal mediumHMM
in-vitro (YM rich medium)Minato 2019 mSysgrowth advantageYM rich mediumHMM7H9 supplemented with ~20 metabolites (amino acids, cofactors)
differentially essential in YM rich mediumMinato 2019 mSysNO (LFC=1.51)YM rich vs minimal mediumresampling

Analysis of Positive Selection in Clinical Isolates *new*

global set of 10,626 Mtb clinical isolates
under significant positive selection?NO
omega peak height (95%CI lower bound)1.89 (0.68)
codons under selection
omega plotsomega plot across ORF
genetic variants*link
* example format for variants: "D27 (GAC): D27H (CAC,11)" means "Asp27 (native codon GAC) mutated to His (codon CAC) in 11 isolates"



TnSeq Data No data currently available.
  • No TnSeq data currently available for this Target.
RNASeq Data No data currently available.
  • No RNA-Seq data currently available for this Target.
Metabolomic Profiles No data currently available.
  • No Metabolomic data currently available for this Target.
Proteomic Data No data currently available.
  • No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology
  • BioCyc

    Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

    NOTE: see table of TFOE interactions below

    Interactions based on ChIPSeq data

  • Interactions based on ChIPSeq data (Minch et al. 2014)

    • Binds To:

      • No bindings to other targets were found.
    • Bound By:

    Interactions based on TFOE data (Rustad et al. 2014)

    TFOE = Transcription Factor Over-Expression study
    significance criteria used in paper: greater than 2-fold change (|LFC|>=1.0) and Padj<0.01

    genedysregulated by OE ofLFC
    Rv2928/tesARv0238/fdmR-1.06
    Rv2928/tesARv3416/whiB3-1.13
    Rv2928/tesARv3849/espR-1.16
    Rv2928/tesARv3417c/groEL1-1.33
    Rv2928/tesARv0260c/nnaR-1.52


    TBCAP

    Tubculosis Community Annotation Project (
    Slayden et al., 2013)

    Rv2928 (tesA)

    PropertyValueCreatorEvidencePMIDComment
    TermTBRXN:PREPHACPH fatty-acyl-ACP hydrolase - ISSnjamshidiISS15668773for phthiocerol chain synthesis, see PMID: 15668773
    A. Rao & A. Ranganathan Interaction studies on proteins encoded by the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. Mol. Genet. Genomics 2004
    CitationInteraction studies on proteins encoded by the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. A. Rao & A. Ranganathan Mol. Genet. Genomics 2004njamshidiIPI15668773for phthiocerol chain synthesis, see PMID: 15668773
    TermEC:3.1.2.14 Oleoyl-[acyl-carrier-protein] hydrolase. - IPInjamshidiIPI15668773for phthiocerol chain synthesis, see PMID: 15668773
    A. Rao & A. Ranganathan Interaction studies on proteins encoded by the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. Mol. Genet. Genomics 2004
    TermTBRXN:PREPHACPH fatty-acyl-ACP hydrolase - IPInjamshidiIPI15668773for phthiocerol chain synthesis, see PMID: 15668773
    A. Rao & A. Ranganathan Interaction studies on proteins encoded by the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. Mol. Genet. Genomics 2004
    CitationInteraction studies on proteins encoded by the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. A. Rao & A. Ranganathan Mol. Genet. Genomics 2004njamshidiISS15668773for phthiocerol chain synthesis, see PMID: 15668773
    TermEC:3.1.2.14 Oleoyl-[acyl-carrier-protein] hydrolase. - ISSnjamshidiISS15668773for phthiocerol chain synthesis, see PMID: 15668773
    A. Rao & A. Ranganathan Interaction studies on proteins encoded by the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. Mol. Genet. Genomics 2004
    TermTBRXN:PREPPACPH fatty-acyl-ACP hydrolase - ISSnjamshidiISS15668773for phthiocerol chain synthesis, see PMID: 15668773
    A. Rao & A. Ranganathan Interaction studies on proteins encoded by the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. Mol. Genet. Genomics 2004
    CitationInteraction studies on proteins encoded by the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. A. Rao & A. Ranganathan Mol. Genet. Genomics 2004njamshidiIPI15668773for phthiocerol chain synthesis, see PMID: 15668773
    TermEC:3.1.2.14 Oleoyl-[acyl-carrier-protein] hydrolase. - IPInjamshidiIPI15668773for phthiocerol chain synthesis, see PMID: 15668773
    A. Rao & A. Ranganathan Interaction studies on proteins encoded by the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. Mol. Genet. Genomics 2004
    TermTBRXN:PREPPACPH fatty-acyl-ACP hydrolase - IPInjamshidiIPI15668773for phthiocerol chain synthesis, see PMID: 15668773
    A. Rao & A. Ranganathan Interaction studies on proteins encoded by the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. Mol. Genet. Genomics 2004
    CitationInteraction studies on proteins encoded by the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. A. Rao & A. Ranganathan Mol. Genet. Genomics 2004njamshidiISS15668773for phthiocerol chain synthesis, see PMID: 15668773
    TermEC:3.1.2.14 Oleoyl-[acyl-carrier-protein] hydrolase. - ISSnjamshidiISS15668773for phthiocerol chain synthesis, see PMID: 15668773
    A. Rao & A. Ranganathan Interaction studies on proteins encoded by the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. Mol. Genet. Genomics 2004
    CitationInteraction studies on proteins encoded by the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. A. Rao & A. Ranganathan Mol. Genet. Genomics 2004razeeth.newIPI15668773two-hybrid (Physical interaction)
    InteractionPhysicalInteraction Rv2935razeeth.newIPItwo-hybrid (Physical interaction)
    A. Rao & A. Ranganathan Interaction studies on proteins encoded by the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. Mol. Genet. Genomics 2004
    CitationLong-chain multiple methyl-branched fatty acid-containing lipids of Mycobacterium tuberculosis: biosynthesis, transport, regulation and biological activities. authors,M. Jackson,G. Stadthagen,B. Gicquel Tuberculosis (Edinb) 2007razeeth.newIPI17030019two-hybrid (Physical interaction)
    InteractionPhysicalInteraction Rv2935razeeth.newIPItwo-hybrid (Physical interaction)
    authors,M. Jackson,G. Stadthagen,B. Gicquel Long-chain multiple methyl-branched fatty acid-containing lipids of Mycobacterium tuberculosis: biosynthesis, transport, regulation and biological activities. Tuberculosis (Edinb) 2007
    InteractionRegulatedBy Rv0348yamir.morenoIEPMicroarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
    B. Abomoelak, EA. Hoye et al. mosR, a novel transcriptional regulator of hypoxia and virulence in Mycobacterium tuberculosis. J. Bacteriol. 2009
    NameType II thioesterase thought to be involved in the release of phthiocerol and phenolphthiocerol from PpsE in the biosynthesis of phthiocerol dimycocerosates and phenolic glycolipidsmjacksonIMPPhthiocerol dimycocerosates (PDIM), phenolic glycolipids (PGL) and para-hydroxybenzoic acid derivatives
    OtherTBPWY:Phthiocerol dimycocerosates, PGL & pHBADmjacksonType II thioesterase thought to be involved in the release of phthiocerol and phenolphthiocerol from PpsE in the biosynthesis of phthiocerol dimycocerosates and phenolic glycolipids (phenotypic [mycobacterial recombinant strains])
    SJ. Waddell, GA. Chung et al. Inactivation of polyketide synthase and related genes results in the loss of complex lipids in Mycobacterium tuberculosis H37Rv. Lett. Appl. Microbiol. 2005
    CitationInactivation of tesA reduces cell wall lipid production and increases drug susceptibility in mycobacteria. authors,SS. Chavadi,UR. Edupuganti,O. Vergnolle,I. Fatima,SM. Singh,CE. Soll,LE. Quadri J. Biol. Chem. 2011mjackson21592957Type II thioesterase thought to be involved in the release of phthiocerol and phenolphthiocerol from PpsE in the biosynthesis of phthiocerol dimycocerosates and phenolic glycolipids (phenotypic [mycobacterial recombinant strains])
    OtherTBPWY:Phthiocerol dimycocerosates, PGL & pHBADmjacksonType II thioesterase thought to be involved in the release of phthiocerol and phenolphthiocerol from PpsE in the biosynthesis of phthiocerol dimycocerosates and phenolic glycolipids (phenotypic [mycobacterial recombinant strains])
    authors,SS. Chavadi,UR. Edupuganti,O. Vergnolle,I. Fatima,SM. Singh,CE. Soll,LE. Quadri Inactivation of tesA reduces cell wall lipid production and increases drug susceptibility in mycobacteria. J. Biol. Chem. 2011
    CitationA Mycobacterium marinum TesA mutant defective for major cell wall-associated lipids is highly attenuated in Dictyostelium discoideum and zebrafish embryos. authors,L. Alibaud,Y. Rombouts,X. Trivelli,A. Burguire,SL. Cirillo,JD. Cirillo,JF. Dubremetz,Y. Gurardel,G. Lutfalla,L. Kremer Mol. Microbiol. 2011mjackson21375593Type II thioesterase thought to be involved in the release of phthiocerol and phenolphthiocerol from PpsE in the biosynthesis of phthiocerol dimycocerosates and phenolic glycolipids (phenotypic [mycobacterial recombinant strains])
    OtherTBPWY:Phthiocerol dimycocerosates, PGL & pHBADmjacksonType II thioesterase thought to be involved in the release of phthiocerol and phenolphthiocerol from PpsE in the biosynthesis of phthiocerol dimycocerosates and phenolic glycolipids (phenotypic [mycobacterial recombinant strains])
    authors,L. Alibaud,Y. Rombouts,X. Trivelli,A. Burguire,SL. Cirillo,JD. Cirillo,JF. Dubremetz,Y. Gurardel,G. Lutfalla,L. Kremer A Mycobacterium marinum TesA mutant defective for major cell wall-associated lipids is highly attenuated in Dictyostelium discoideum and zebrafish embryos. Mol. Microbiol. 2011
    CitationInteraction studies on proteins encoded by the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. A. Rao & A. Ranganathan Mol. Genet. Genomics 2004mjackson15668773Type II thioesterase thought to be involved in the release of phthiocerol and phenolphthiocerol from PpsE in the biosynthesis of phthiocerol dimycocerosates and phenolic glycolipids (phenotypic [mycobacterial recombinant strains])
    OtherTBPWY:Phthiocerol dimycocerosates, PGL & pHBADmjacksonType II thioesterase thought to be involved in the release of phthiocerol and phenolphthiocerol from PpsE in the biosynthesis of phthiocerol dimycocerosates and phenolic glycolipids (phenotypic [mycobacterial recombinant strains])
    A. Rao & A. Ranganathan Interaction studies on proteins encoded by the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. Mol. Genet. Genomics 2004
    CitationInactivation of polyketide synthase and related genes results in the loss of complex lipids in Mycobacterium tuberculosis H37Rv. SJ. Waddell, GA. Chung et al. Lett. Appl. Microbiol. 2005mjackson15715645Type II thioesterase thought to be involved in the release of phthiocerol and phenolphthiocerol from PpsE in the biosynthesis of phthiocerol dimycocerosates and phenolic glycolipids (phenotypic [mycobacterial recombinant strains])

    Comments